KEGG   Paraburkholderia graminis: CUJ91_14365Help
Entry
CUJ91_14365       CDS       T05548                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pgp  Paraburkholderia graminis
Brite
Enzymes [BR:pgp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CUJ91_14365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AXF08962
UniProt: A0A2Z5LVJ9
LinkDB All DBs
Position
PHS1_A:complement(3233104..3233682)
Genome map
AA seq 192 aa AA seqDB search
MEHTLPPLPFAKNALAPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEEIVKKS
SGGVFNNAAQVWNHTFFWNSLSPQGGGAPTGALADAINAKWGSFDKFKEEFAKTAIGTFG
SGWAWLVKKADGSLDLVSTSNAATPLTTDAKALITIDVWEHAYYIDYRNARPKFVEAYWN
IVNWEFASKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaacatacgctcccgccgctgccgttcgcgaaaaacgcactcgctccgcacatgtcg
gaagagacgctcgagtttcactacggcaagcaccaccagacctatgtgaccaacctgaac
aatctgatcaagggcacggagttcgagaatctgtcgctcgaagaaatcgtgaagaagtcg
tcgggcggcgtgttcaataacgcagctcaagtgtggaaccacacgttcttctggaacagc
ctgtcgccgcaaggtggcggtgcaccgaccggcgcgctggccgacgcgatcaacgccaag
tggggctcgttcgacaagttcaaggaagagttcgcgaagaccgcaatcggcacgttcggc
tcgggctgggcatggctcgtgaagaaggcagacggttcgctcgacctcgtgtcgacgagc
aacgctgcgacgccgctgaccacggacgccaaagcgctgatcacgatcgacgtgtgggaa
cacgcgtattacatcgactatcgcaacgcgcgtccgaagtttgtcgaagcttactggaac
atcgtcaactgggaattcgcgtcgaagaacttcgcgtga

DBGET integrated database retrieval system