KEGG   Paraburkholderia graminis: CUJ91_19555Help
Entry
CUJ91_19555       CDS       T05548                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pgp  Paraburkholderia graminis
Pathway
pgp00440  Phosphonate and phosphinate metabolism
pgp01100  Metabolic pathways
pgp01120  Microbial metabolism in diverse environments
pgp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    CUJ91_19555 (aepX)
Enzymes [BR:pgp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     CUJ91_19555 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase NAD_binding_7 YfdX
Motif
Other DBs
NCBI-ProteinID: AXF10194
UniProt: A0A2Z5M085
LinkDB All DBs
Position
PHS1_B:311584..313308
Genome map
AA seq 574 aa AA seqDB search
MNAREPAFVSSSRSARLRQMLVSSELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADIDEFCGKIKAGKDSQSDENFSIVARVEALIAGWGMEEALR
RAEAYRRAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAQEIHTSQTLVNVEDRIAAVNEIFRLQDADEYSEAEDRYLSS
GRAAGAAVVLAASRGKGLEAVTEDRPKVMLPVAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIKLVVNDKHEQTGELASLACALDKLSGDTVISYGDLLFRSYILRDLVESEAA
FSVVVDSSLTDAENASVRDFAWCSASDDRGLFGNKVVLRHVSSGQEASAAIAAQTPHGRW
VGLLNVRGAGRERLQTVMAQLQARADFASLDMPALLNALIEAGESIEVQYVHGHWRGVND
LEDFRRAGDFAHGQTPLAASVGGAASDAASGAAQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgcgaacccgccttcgtctcttcttcacgcagcgcacgtctgcgccagatg
cttgtcagcagcgaactcgaattcatgatggaggcgcataacggcctctccgcgcgcatc
gtccgcgaagccggcttcaaggcgatctggggctcgggcctcgcgatctccgcgcaattc
ggcgtgcgcgacaacaacgaggcaagctggacccaggtcgtcgacaacctcgaattcatg
gccgacgcaagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaac
aacgtgcgccgccttgtgcgcaagctcgaacaacgcggcatcgccggcgtgtgcatcgaa
gacaagcagttcccgaagaccaatagcttcatcaacggcgaggcgcagccgcttgccgac
atcgacgaattctgcggcaagatcaaggccggcaaggactcgcaatcggacgagaatttt
tcgatcgtcgcgcgcgtggaagcgctgattgccggctggggcatggaagaagcgctgcgc
cgcgcggaagcctaccgccgcgccggcgccgacgcgatcctgattcacagcaagctctcg
cgccccgacgaaattctcgagttcgcgcgcgagtgggcgggccgcgggccgctcgtgatc
gtgccgaccaagtactacagcacgccgaccgaagtgttccgcgaagccggcatcagcacc
gtgatctgggcgaaccatctgattcgcgcggccacgtcggcgatgcaggcggtcgcacaa
gaaatccacacgagccaaacgctcgtcaacgtggaagaccgcatcgccgcggtcaacgaa
attttccgtttgcaggacgccgacgagtattcggaagcggaagaccgctatctgtcgagc
ggccgcgcggcaggcgccgcggtcgtgctcgcggcgagccgcggcaagggcctcgaggcc
gtcaccgaagaccgtccgaaagtgatgctgccggttgcgggcaagccgctgctgcgctgg
ctcgtcgacgcgttcaagaagcagggcgtcaacgacatcacggtggtcggcggttatcgc
gccgatgcaatcgatacggcgggcatcaagctcgtcgtcaatgacaagcacgagcaaacc
ggcgaactcgcgtcgctcgcgtgcgcgctcgacaagctctcgggcgacaccgtgatctcg
tacggcgatctgctgttccgcagctacatcctgcgcgatctggtggagagcgaggcggcc
ttcagcgtggtcgtcgattcttcgctgaccgatgcggaaaacgccagcgtgcgcgacttc
gcgtggtgctcggcttccgacgaccgcggcctgttcggcaacaaggtcgtattgcgccat
gtgtcgagcggacaggaggcgtcggcggcgatcgccgcacaaacgccgcatggccgctgg
gtcggtttgctcaacgtgcgtggcgcaggccgcgagcgtctgcagactgtcatggcgcaa
ttgcaggcgcgcgccgactttgcatcgctcgacatgcccgcgttgctgaacgcgctgatc
gaagcaggcgagtcgatcgaagtgcaatacgtgcacggccattggcgcggcgtcaacgat
ctcgaagacttccgccgcgccggcgacttcgcgcacggacagacgccgctcgcggcatcg
gtcggcggtgcggcctccgacgcagcgagcggagcggcgcaatga

DBGET integrated database retrieval system