KEGG   Paraburkholderia graminis: CUJ91_23380Help
Entry
CUJ91_23380       CDS       T05548                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pgp  Paraburkholderia graminis
Pathway
pgp00500  Starch and sucrose metabolism
pgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CUJ91_23380
Enzymes [BR:pgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CUJ91_23380
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CUJ91_23380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AXF12392
UniProt: A0A2Z5M5C1
LinkDB All DBs
Position
PHS1_B:1160592..1162256
Genome map
AA seq 554 aa AA seqDB search
MLNDLWYKNAIVYCLSVGTFMDANGDGVGDFKGLLRRLDYLQGLGVTTVWLMPFQPSPGR
DNGYDICDYYNVDPKYGTLGDFSEFTHACRERGLRVMIDLVINHTSDQHPWFREARSDPE
SQYRDWYVWSDRQPPNAKDGVVFPGVQKSTWSFDKQAKRWYFHRFYDFQPDLNTANPYVR
AELLKIMGFWIQLGVSGFRMDAVPFVIATKGPKVKKPVEQYDMLRAFREFLQWRQGDAII
LAEANVLPNTDLEYFGDQGERLQMMFNFQLNQHTFYTLATGDTAPLKKALTATRPRPSTA
QWGVFLRNHDELDLGRLTPEQRDAVFAAFAPEPDMQLYERGIRRRLAPMLAGDRRRLELA
YSLMLTLPGTPVFRYGDEIGMGDDLRLPERECARTPMQWSTEPEGGFTKHPKPPCRVITG
GAYGFERINVATQRRDPNSLLNWMERMIRMRREVPEISWGDFAVLRTSRNDVLALRYDWR
NNSVICLHNFGAQACTVKFRSGCKEPEQNRLINLLSDDHSEEKDDGRHAVVLEPYGYRWF
RVGGLDYLLRRGEV
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatgacctttggtacaagaacgcgattgtgtattgcctctcggtaggcacgttc
atggacgcgaacggcgacggtgtcggcgacttcaagggccttctgcgccgcctcgactac
ctgcaggggctcggcgtgacgacggtgtggctgatgcctttccagccttcgccggggcgc
gataacggctacgacatctgcgactactacaacgtcgatccgaaatacggcacgctcggc
gacttctccgagttcacgcatgcgtgccgcgagcgcggcttgcgcgtgatgatcgacctg
gtcattaatcacacgtccgatcagcacccgtggttcagggaagcacgcagcgatcctgag
tcgcagtatcgcgactggtatgtctggtccgacaggcagccgccgaacgccaaagacggc
gtggtatttcccggcgtgcagaagtccacatggtcgttcgacaagcaggcgaagcgctgg
tatttccatcgcttctacgactttcagccggacctcaacacggcgaacccgtacgtgcgc
gcggaattgctgaagatcatgggcttctggatccagctcggcgtgtcgggctttcgcatg
gacgcggtgcctttcgtgatcgcgacgaaaggcccgaaggtcaagaagcccgtcgagcaa
tacgacatgctgcgcgcgtttcgcgagttcctgcaatggcgtcagggcgacgcgatcatt
ctcgccgaggccaacgtgctgcccaataccgacctcgaatatttcggcgatcagggcgag
cgtctgcagatgatgttcaatttccagctcaatcagcacacgttctacacgctggcaacc
ggcgataccgcgccgctgaaaaaagcgctgacggccacgcggccgcgtccgtcgaccgcg
caatggggcgtgtttctgcgcaatcacgacgagctcgatcttggccgcctcacgcccgag
cagcgcgacgccgtgtttgccgcgttcgcgcccgagcccgacatgcagctctatgagcgc
ggcattcgccgccggcttgcgccgatgctcgcgggcgaccggcgccggctcgaactcgcc
tacagtctgatgctgacgttacccggcacgccggtgttccgttacggcgatgaaatcggc
atgggcgacgacctgcgcctgcccgagcgcgaatgcgcgcgcacgccgatgcaatggtcg
acggaaccggaaggcggcttcaccaagcacccgaagccgccgtgccgcgtgatcacgggc
ggcgcttacgggttcgagcgcatcaatgtcgcgacgcagcggcgcgatccgaattcgctg
ctgaactggatggaacgcatgatccgcatgcgccgcgaagtgccggaaatcagttggggc
gacttcgccgtgctgcgcacctcgcgcaacgatgtgctcgcgcttcgctacgactggcgc
aacaactcggtgatatgcctgcataacttcggcgcgcaggcatgcacggtgaaattccgc
tcgggctgcaaggagccggaacagaaccggctcatcaacctgctctcggacgatcacagc
gaggagaaggacgacggccgtcatgcggtcgtgctcgagccgtatggctatcgatggttt
cgggtcggcgggctcgattatctgctacggcgcggcgaggtctag

DBGET integrated database retrieval system