KEGG   Paraburkholderia graminis: CUJ91_26500Help
Entry
CUJ91_26500       CDS       T05548                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pgp  Paraburkholderia graminis
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pgp01001]
    CUJ91_26500
Enzymes [BR:pgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CUJ91_26500
Protein kinases [BR:pgp01001]
 Serine/threonine kinases: Other
  Bacterial family
   CUJ91_26500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-ProteinID: AXF11406
LinkDB All DBs
Position
PHS1_B:1878263..1879720
Genome map
AA seq 485 aa AA seqDB search
MTATSGAPRQIGRYLVDGVLGRGAMGTVYLATDPHIQRQVALKTINPELLRDSQQGSSAA
DAELPARFINEARAAGRLVHPHIVGVFDYGEADGVPFIALEYVRGETLAARLAKEALHGT
RLPLVRTLAWFAQLLDALAYAHEAGVIHRDIKPANLLIAPRGECKIADFGIAQLDTGRLT
QIGMMIGTPAYMSPEQYTGAPIDARSDLFSAGVVLYEMLTGKCPFAGSSAAVMQQVLNGM
PPAPSSETPGLPTSLDAMVRKALAKEPKARYLSAQSWRAELIGLLDTLAAERDPDETVVA
APVNREALAPPIITATAHAVSADSVVWPPELLAQLEERLAHHVGPVASLLVRRAAAHATN
PRMLAAQLARHLPDEATRHQFDTLLQRHTAGQGSASSRPVSESIQPAARVASTQARVPDA
AHIEAAARQLATHIGPVARIVAQRAALGVDTATFHNRLADALPATVDRSAFLRALSERLA
DACGP
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacgagcggagcgccgcggcagatcggccgttatctggtcgatggcgtgctt
ggccgcggcgcgatgggcaccgtttatctcgccaccgacccgcatatccagcggcaagtc
gcactcaagacgatcaaccccgagttgctgcgcgactcgcagcaagggagcagcgcagcc
gacgcggaactgcccgcgcgctttatcaacgaggcgcgcgcggccgggcggctcgtgcac
ccgcatatcgtcggtgtgttcgactatggcgaggccgacggcgtcccgtttatcgcactc
gaatatgtgcgcggagaaacgctcgccgcacggctcgcgaaagaggccctgcatggcacg
agattgccgctcgtgcgcacgctcgcgtggttcgcgcagttgctggacgcgctggcgtat
gcgcacgaggctggcgtgatccatcgcgacatcaagcccgccaatctgctgattgcgccg
cgtggcgaatgcaagatcgccgacttcggcatcgcgcaactggacacgggccgtctgacg
cagataggcatgatgatcggcacgcctgcgtatatgtcgcccgagcagtacacgggcgca
ccgatcgacgcacgcagcgatctgttttccgcgggcgtcgtgctgtacgagatgctgacc
ggcaagtgcccgttcgccggctcatcggcggctgtcatgcaacaggtgttgaacggcatg
ccgcccgcgccgtcgagcgaaacgcctggccttccaacctcgctcgatgcgatggtgcgc
aaggcgcttgcaaaagagcccaaggcacgctacctgtccgcgcaaagctggcgcgcggag
ttgataggcctgctggatacgctcgcggcggaacgcgatccggacgagacggtggtcgcg
gcgccggtgaatcgcgaggcgcttgcaccaccgatcatcaccgctactgctcacgcggta
tccgccgattctgtcgtctggcctccggaattgctggcgcagctcgaagagcggctcgcg
caccacgttgggccggttgcgtcgctgctcgtgcggcgggcggcggcacacgcaacgaac
ccgcgcatgctggcggcacaactcgcgcgtcatcttcccgacgaagcgacacgtcatcaa
ttcgacacgctgttgcaacggcatactgccgggcagggaagcgcgtcttcgcggccggtg
agcgagagcattcaacctgcggcacgcgtcgcttctacccaggcacgcgtgcccgatgcc
gcgcatatcgaagcagccgcacggcagcttgcaacgcatattgggcccgtcgcccgcatc
gtcgcgcagcgggctgcgctgggcgtcgacaccgcgacctttcacaaccggctcgccgat
gcacttcccgccaccgtcgacagatccgcgtttcttcgtgcgctgagcgagcggcttgct
gacgcttgcgggccgtga

DBGET integrated database retrieval system