KEGG   Paraburkholderia graminis: CUJ91_28080Help
Entry
CUJ91_28080       CDS       T05548                                 

Definition
(GenBank) NAD(P)H nitroreductase
Organism
pgp  Paraburkholderia graminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AXF11687
UniProt: A0A2Z5M582
LinkDB All DBs
Position
PHS1_B:2233664..2234299
Genome map
AA seq 211 aa AA seqDB search
MKTEINMTNAVIECILSRSAAKYYDPTATLSDEQIHELVRIGTSAPTSFHLQNWRFIAVR
TPEAKARLSPIAWNQPAVKDAAVTFIVCGQLVETSVIPERLAPLVEAGVMPATMVPEWEI
PARNLYMAYPQRRRDEAVRTATFGAAAMIYAARSMGLGSTPMIGFDDEGVHREFGLAADE
VPVLLLSVGVERAGNWAQKPRRPVAEVLDLV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgaaatcaacatgaccaacgccgtcatcgaatgcattctgagccgcagcgcg
gccaagtactacgacccgaccgcgaccttgagcgacgaacagatccacgagctcgtgcgg
atcggtacgagtgcgccgacatccttccacttgcagaactggcgttttatcgcggtacgt
acgcccgaagccaaggcgcgactgagcccgattgcgtggaaccagcccgcggtcaaagat
gcagcggtgactttcatcgtctgcggccagttggtcgaaaccagcgtgattccggagcgt
cttgcaccgctggtggaagcgggcgtcatgcctgcaaccatggtgccggagtgggaaatc
cccgcacgcaatctgtatatggcgtacccgcagcgccgtcgtgacgaggccgtgcgcacc
gcgactttcggcgcggcggcgatgatctatgcagcccgctcgatgggcctaggttctacg
ccgatgatcggtttcgatgacgaaggcgtacaccgcgagttcggactggccgcggacgaa
gtaccggttctgctgttgtccgtaggcgtggagcgagccggaaactgggcgcagaagccg
cgccgtcccgtggccgaagtgctggacctggtatga

DBGET integrated database retrieval system