KEGG   Paraburkholderia graminis: CUJ91_31750Help
Entry
CUJ91_31750       CDS       T05548                                 

Definition
(GenBank) 2,4-dihydroxyacetophenone dioxygenase
Organism
pgp  Paraburkholderia graminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7
Motif
Other DBs
NCBI-ProteinID: AXF12589
LinkDB All DBs
Position
pPHS1_P:71034..71567
Genome map
AA seq 177 aa AA seqDB search
MVDKAVTEFWRNIPPIANPFKPDALPEAYIPNAATEDERYYVPFTETVSSRPLWISPSQN
KWCDILMAKEAGLVNRHYHPHEVFAYTLSGKWGYLEHDWIATKGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDEEGNPDGYFDVHSYIAMCKAHYEKVGLGAQAIEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacaaagccgtaaccgaattctggcgaaacatccccccgattgccaatccgttc
aagcccgatgcgctgcccgaagcctacatcccgaacgcggccaccgaagacgagcgatat
tacgttccgtttactgaaacggtttcgtcgcggccgctgtggatctcgccgtcgcagaac
aaatggtgcgacatcctgatggcaaaggaagcgggcctcgtgaaccggcactatcacccg
catgaggtgttcgcctacacgctgtccggcaaatggggctacctggaacacgattggatc
gcgacgaagggcgatttcgtgtacgagacgcccggcgaaggccacacgctcgtcgcattc
gaccatccggagccaatgcgcgcgttcttcatcgtcaaggggccgctgatctggctcgac
gaagaaggcaaccccgacggctatttcgacgtgcactcgtacatcgcgatgtgcaaggcg
cattacgagaaggtcggcctcggcgcgcaagcgatcgaaaagctgttccgctga

DBGET integrated database retrieval system