KEGG   Paraburkholderia graminis: CUJ91_31755Help
Entry
CUJ91_31755       CDS       T05548                                 

Definition
(GenBank) MFS transporter
Organism
pgp  Paraburkholderia graminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr LacY_symp MFS_1_like MFS_2
Motif
Other DBs
NCBI-ProteinID: AXF12590
LinkDB All DBs
Position
pPHS1_P:71586..72887
Genome map
AA seq 433 aa AA seqDB search
MTSHSAPKLAWTYENRLLLILFMTFGFVFFDRLALSFLFPLMSAELHLTNAQLGMVSSAL
SLTWALSGAATGAWSDARGTRKPLLIAAVLGFSICSALSGLVAGFVSLIAFRALMGIAEG
PVLPLSQSLMVESSTPSRRGMNMGLLQGSAAGLLGAMIGPPVVIGMATAYGWREAFYVSC
IPGLLIAFCIWRWVREVPPGGVRHAQAEGAATQAAGGTTVSRWALLKERNILLCVLISCC
FLTWFVVIISFAPVFLVENRHLSPSGMGVVMTCLGAAWVLWGFAVPAISDRIGRKPTMIA
FALIAAVCPIVLIHGDSVWALGTLVFVTYTGLGCFTLFMATIPAETVRPRAIAGALGLIM
GAGELMGGFVAPTVAGFAADKYGLQFAMWMSAVGAILACVLSFALVETAPAVLRRRALAC
AAARLDTQNVGGR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccattccgcccccaagctcgcgtggacgtacgagaacaggctgcttctgatt
ctgttcatgacgttcggtttcgtgttctttgaccgcctggcgctatcgttcctttttccg
ctcatgtccgccgaactgcacctgacgaatgcgcagcttggcatggtgtcgtccgcgctt
tcgctcacgtgggcgctgtccggcgccgcgaccggcgcgtggtccgacgcgcgcggtacc
cgcaagccgctgttgatcgcggcggtgcttggcttttccatctgctctgcgctgtcgggg
ctcgttgccggcttcgtgagcctgatcgcgtttcgcgcgctgatggggatcgctgagggg
cccgtgctgccgttgtcacaatcgctgatggtcgagagctcgacgccgagccgccgcggg
atgaacatgggcctgctccagggctcggccgccggcctgcttggcgcgatgatcggcccg
ccagtagtgatcgggatggcgaccgcatacggctggcgagaggcgttctacgtgtcgtgc
attcccggcttgctgatcgcgttctgcatctggcgctgggttcgcgaagtgccgcccggc
ggcgtacggcacgcgcaggccgaaggcgcggccacacaggctgcgggaggcacgacggtc
agccgctgggcgttgctgaaggaacgcaacatcctgctgtgcgtgctgatcagctgctgc
ttcctcacgtggttcgtcgtgatcatctcgttcgcgccggttttcctcgtcgagaaccgc
cacctgtccccgtccggtatgggcgtcgtgatgacctgcctcggcgccgcatgggtgctt
tggggttttgcggtgcctgcgatctccgaccggatcggccgcaagccgacgatgatcgcg
ttcgcgctgatcgccgccgtctgcccgatcgtgttgatccatggcgattcggtctgggcg
ctgggcacgctcgtgttcgtcacgtacacgggcctcggctgcttcacgctgttcatggcg
acgatcccggcggaaacggtccggccacgcgcgatcgccggcgcgctcgggctgatcatg
ggcgcgggcgaattgatgggcggcttcgtcgcgccgaccgtcgcgggcttcgcggcggac
aagtacggtctgcagttcgccatgtggatgtcggctgtcggcgcgatcctcgcgtgcgtg
ctgtcgttcgccctcgtcgaaactgcgcccgccgtgctgcgcaggcgcgcgcttgcctgc
gcagctgcccgcctcgatacgcaaaacgtcggaggacgctga

DBGET integrated database retrieval system