KEGG   Paraburkholderia graminis: CUJ91_31765Help
Entry
CUJ91_31765       CDS       T05548                                 

Definition
(GenBank) 2-deoxy-D-gluconate 3-dehydrogenase
Organism
pgp  Paraburkholderia graminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase Glyco_trans_4_4 KR Glyco_transf_4 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: AXF12592
LinkDB All DBs
Position
pPHS1_P:73984..74706
Genome map
AA seq 240 aa AA seqDB search
MNRLFTFEGRTAVVTGGTSGIGARTALRLAEAGASVVALGLDANGPHAPVHERIRCIELN
VTDSGALTGTIAALPRLDVLVNGVGISRHANEYRMDQFELVLNVNLTSVMRASDAALPAL
SACGGSIVNVASMYTYFGSKDRPAYSASKGGIAQLTRSLAQAWADRGIRVNAVAPGWIDT
PLSAVLKADTQASRQILERTPLGRWGAADEVADVILFLCSPGASFVTGAVVPVDGGYSTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggctgttcacgtttgaaggcaggactgccgtcgtaacgggcggcacatcgggc
atcggcgcgcgcaccgcgttgcggctcgcggaagccggcgcatcggtcgtcgcgctcggg
ctcgatgccaacggcccgcatgcgcccgtgcatgagcgcatccggtgcatcgaactgaac
gtgactgacagcggtgcgctgacgggcacgatcgccgcgctgccccgacttgacgtgctg
gtcaacggcgtcggcatcagccggcacgctaacgaataccggatggaccagttcgagctc
gtattgaacgtaaacctgacgtcggtgatgcgtgcctccgacgccgcattgccggcgctg
tcggcatgcggcggcagcatcgtgaacgtcgcatcgatgtacacgtacttcggcagcaag
gaccggcccgcgtacagcgcgagcaagggcgggatcgctcagctcacgcgctcgctcgcg
caggcgtgggccgatcgcggcattcgcgtaaacgcagtcgcgcccggttggatcgacacg
ccgctcagcgccgtgctgaaggctgacacgcaggcgtcgcggcagatcctcgagcgcacg
ccgctcgggcgctggggcgcagccgacgaagtcgcggacgtgatcctgttcctgtgctcg
cccggcgcgtcgttcgttaccggtgcggtcgtaccggtcgacggcgggtattcgacggtc
tag

DBGET integrated database retrieval system