KEGG   Puccinia graminis: PGTG_01888Help
Entry
PGTG_01888        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pgr  Puccinia graminis
Pathway
pgr00052  Galactose metabolism
pgr00500  Starch and sucrose metabolism
pgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PGTG_01888
   00500 Starch and sucrose metabolism
    PGTG_01888
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PGTG_01888
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 10542761
NCBI-ProteinID: XP_003319714
UniProt: E3JTH0
LinkDB All DBs
AA seq 896 aa AA seqDB search
MILFSVAASLWWLSAVLSVSRAEKCPSYVLSELNKTVDGFDASLMLNGSPCQADDIASLK
LIVNYDTDERLHVRIVDAGKKRYEVPDFLFPRPIHSTNVLPKSSANTGLVFSYETAPFSF
TVSRRSTREVLFSTISHPIIYRDKHIQIATQLSPNANIYGLGESTDTFRINLDGNGTRRT
MWARDAYGTQKGTNLYGTHPIYYDHRPNGTHGVFLLNSNGMDITLNKESIQYDVTGGVLD
FYFLAGPSPVKVAEQYSALAGLPAMIPYWSLGFQQCRYGYSNYVEVAEVIANYSKAGIPL
ETMWTDIDYMYKRRTFTLDPDYFPLNRMQEIVKSLHKNNQRYVMMIDPAVAYQPGDKGTF
DRGTEADVFMKEKDGKVFQGVVWAGVSVYPDWFHPNAEAFWINEIERFFNPTNGIDIDGI
WIDMNEPANFALPCAYPCNNTNLLPGAQAIASGNPPARKNPPPPKDVPLPIGKLHGRRGV
EDNTQYQIHNAAGELAKGTIRTDLVHHNGLTEYDVHNLYGTFMSWITRKAMLHRRSKVRP
QVVTRSTFAGAGAYVAHWTGDNLSDWTHYLSSITEIMSFAALFQIPLVGADVCGFGSNTN
EELCARWASLGAFYPFYRNHNELGMISQEFYRWESVARSARNAIKTRYSLLDYFYTHMRR
QSLTGEPALKPLWFAYPQDTSTFGIDKQFFFGDAILISPVVEANSITVNAYFPESNYIEF
SSRKIVGNSGNIDLKNIQIDQIPVHIKPGSILPIRQVATNQTLAMTTTEVRSKSFEILVL
PNSSGSAKGSLYLDDGESLEPLAEETADLEFTYDQRVLHISGRLGSRLKDISISVGQWTF
SNVPNIQKIKGMRVIDSPQLESGAQLLPVHVDAKTRSIYARGNWKLAPGMKIALVY
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgatactattttcagtcgcagcttcactctggtggctttcagcagtgttatctgtttct
agagcagaaaaatgcccgtcttacgtgctctcggaactaaacaaaaccgtggacggattc
gatgcgtcactaatgctgaatggttcgccatgccaagctgatgacattgcatctttgaaa
ttgattgtgaattatgacacagacgagcgtcttcacgttcggattgtggacgctgggaag
aagcgttacgaagtcccagattttctgtttccacgtcctatccactctacgaatgtgctc
ccaaagagttctgccaataccggtcttgtgttttcatacgaaactgcacccttttctttt
actgtttcccgccgaagcacccgggaagttttattctcaacgatttcgcatcctatcatc
taccgggataaacacatccagatcgcgactcaattgtctccaaatgccaatatttacggc
ttgggagaaagcactgatacgttccggatcaacttggatggaaatggcactcggagaacc
atgtgggcacgggatgcatacgggacacaaaagggaaccaacttatatgggacacatccc
atatactacgaccatagacccaatggcacacatggggttttcctcttgaactcgaatgga
atggacattactttgaacaaggaatcgattcaatatgacgttactggtggggtgctggat
ttttacttcctggcagggccctcaccggtgaaggttgctgagcagtattccgcgctagcc
ggtctgcccgccatgataccgtactggtcccttggtttccagcaatgcagatatggatac
tcaaattatgtcgaagtggccgaagtaattgctaattattccaaagcaggaattccattg
gagacaatgtggaccgacatcgattacatgtacaaacgccgcacttttacgcttgaccct
gattattttccgctgaatcggatgcaggagattgtcaaatcactccacaaaaacaatcaa
cgttacgtgatgatgatcgatccagccgtagcttaccaacctggggacaaaggaaccttt
gatcgaggcacggaggctgatgtattcatgaaagagaaagacgggaaggtctttcaaggg
gtagtttgggcaggcgttagtgtgtatccagattggtttcatccaaatgctgaggcgttc
tggattaatgagatcgaaagattctttaatccgacaaacggtatcgacatcgatggaatt
tggatagacatgaatgagcctgccaattttgccttaccttgtgcctatccgtgtaacaac
acaaacttattgcccggtgcccaggccattgcatctggaaacccaccggcacgtaagaac
cctcctcctccgaaagatgttcctctacctattggaaaactacatggccgtcgaggggtg
gaggacaacactcaatatcaaatacataatgccgctggagaacttgccaagggaactatt
cgcacggacttggttcatcacaacggattaaccgagtatgatgtccacaacctctacggt
actttcatgtcttggatcactcgcaaagcaatgctacatcgaagaagcaaggtgcgacct
caagtagtgacccgatcaacttttgcaggcgccggagcatatgttgctcattggactggc
gataatctctccgattggacccattatctgtcttccatcaccgaaatcatgtcatttgct
gcactcttccaaattcctctggttggcgcggatgtctgcggttttggctctaatactaat
gaagaactttgtgccagatgggcgtccttgggggcattttatccattttatcgaaatcac
aatgagcttggcatgatcagtcaagaattttaccgttgggaatctgtagctcgctctgct
agaaatgcgatcaagactagatacagcctgttggattatttctacactcacatgagaagg
cagagcttgaccggtgaacctgccctaaaacctctttggtttgcgtaccctcaagacaca
tcaacatttgggatcgacaaacaatttttctttggagatgctattttgatctcaccagtc
gttgaggcgaattctataacagtcaatgcttatttcccggaatctaattacattgaattt
tccagtaggaaaattgtaggcaattcaggtaacatagacttgaaaaacattcaaatagat
cagataccggtacacatcaagccgggatcaattttaccaattcggcaagtcgctaccaac
caaacattagctatgacaacaactgaggtcaggagcaaaagtttcgagatcctagtatta
cctaatagttcaggctcagccaagggttcactatacttggatgatggagaatcgcttgaa
ccgcttgctgaagaaactgccgacttggaatttacctacgatcaacgcgtcttgcacatc
tcgggtcgactaggctccaggttaaaagatataagcatttccgttggccaatggacattt
tcaaacgttccaaacatccaaaaaatcaaggggatgcgtgtaatagacagtcctcagctc
gaatcgggtgcccaactattgcctgtgcatgttgatgcaaaaaccaggtcgatttacgca
cgagggaattggaagctggcaccaggaatgaagattgcattagtctactaa

DBGET integrated database retrieval system