KEGG   Puccinia graminis: PGTG_02336Help
Entry
PGTG_02336        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pgr  Puccinia graminis
Pathway
pgr00500  Starch and sucrose metabolism
pgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PGTG_02336
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PGTG_02336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 HCV_NS4a
Motif
Other DBs
NCBI-GeneID: 10529060
NCBI-ProteinID: XP_003321294
UniProt: E3JXV0
LinkDB All DBs
AA seq 578 aa AA seqDB search
MPSSQFLSRTENLLGSRLVIAVGSLLAGGALYASSTRVPSAIIKSTRSEPLPDDLEYWII
TEKPRALRHLLAAFGPDGSNAPGTVAGVMVASPSRPGSYHDKETENEDYFFHWTRDANLC
LQVVIRKLSEAESGVDLQLVSTRPQEAPGIPSLKRALEVIVRESVTFNGQLQQVLNLSGG
PLDGGLGEPKFLVDGSRFDGPWRRPQNDGPAIRASAMIQYARHLISRRPNLEQVFDFIAA
HLYHRDNPQLQVQLDIDHVCRAWSEPSSDLWEEVEANYGGHFYTLMVQRKSVQDFLDFTR
SLPSEKQPSDQEYYFATLAKMDERLEHFWNPEGLPAREGGNTENPNNSFVPFSTKPHILP
TLDRVDGQPKPSQVDTAVLLAVNHTAGSNQPHNWIPSSDRVLATLDRLVEVFEQLYPINH
SKQGTGIAIGRYPEDEYDGVKSSSVGHPWFLCTHAVAETTYLAISDFRKTVSIPVTRFNL
AFFSRFLPELSESFDDQTPLTIDRGTDEYAKLLNGMSKWADRFLVDVTFKYFDSRDGRMS
EQIDRNTGQMRGARELTWSYASLLSALDAREGKTPNHD
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctctcaattcctgtctcgcactgagaacttgctcggaagtcgactcgtgatt
gcggttggtagtctgcttgctggtggggcattgtatgcgagctcgaccagagtgccatcg
gccatcatcaaatcgactcgatccgaaccactgccggacgatctagagtactggatcatc
acagagaagccacgagcgctgagacatctactggctgccttcggccccgatggtagcaat
gcaccaggaacagttgccggggtcatggtcgcctctccctcacggccgggctcctaccac
gataaggaaaccgagaatgaagactacttttttcattggacccgtgacgctaacttgtgt
ttgcaagtggtaatacgaaaactgagcgaggccgagtcgggcgtcgaccttcaattggtc
tcaacaagaccgcaagaagctccaggtattccatctttgaagcgcgccttggaggtaatc
gtcagggaatcggtcacttttaacggtcaattacagcaagttctcaatctctcaggtggc
cctttggacgggggattgggggaacccaaatttctggtcgatggatctcggtttgatggc
ccttggagaaggccgcaaaatgatgggcctgcaatccgggcaagcgcgatgatccaatat
gcacgacatctgatcagccgacgacccaacctcgaacaggtattcgatttcatagctgct
cacttataccacagggacaatccccaacttcaggtacaactggacattgaccatgtctgc
cgagcctggagtgaaccaagttctgatttgtgggaggaagtcgaagcaaattacggcgga
cacttttacacactcatggtccaaagaaaatccgtccaagactttttagacttcacacga
tctttaccgtctgagaagcagccttcagatcaggaatactatttcgccacattggcaaaa
atggatgaaaggctagaacatttctggaacccagaaggtttgccggccagggagggcggt
aacactgaaaacccaaacaattccttcgtaccattttccacgaagcctcacatcttaccc
acgcttgatcgagtggatggacagcccaaaccatcgcaagttgataccgcagtcttgctg
gccgtcaatcataccgctggatccaatcaacctcataactggatacccagctccgatcgc
gtccttgcaacgcttgaccgtctcgtggaggttttcgaacaactttatccgattaatcat
tctaaacaaggcactggaattgcaattggtcgctacccagaagacgaatatgatggagtg
aagtcaagttctgttggtcatccctggtttctctgcacgcatgcagttgcagaaacgacc
tatctagccatcagtgatttccgaaagacggtgtcgattccagtgactcgcttcaatctc
gccttcttctctcgcttcttgcctgagctgagcgaatcatttgacgaccaaacaccgctc
acaattgaccggggaactgacgagtatgctaagctcttgaacggcatgtccaaatgggca
gatcggtttcttgtcgatgttacgttcaaatactttgactctcgtgatggccggatgagt
gaacaaatcgaccgcaatactggacagatgcgcggagctcgtgaacttacttggagttat
gcatccttgttgtctgccttggatgccagggaaggtaaaacacccaatcatgactaa

DBGET integrated database retrieval system