KEGG   Puccinia graminis: PGTG_04975Help
Entry
PGTG_04975        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pgr  Puccinia graminis
Pathway
pgr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PGTG_04975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pgr02000]
    PGTG_04975
Enzymes [BR:pgr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PGTG_04975
Transporters [BR:pgr02000]
 Other Transporters
  Pores ion channels [TC:1]
   PGTG_04975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 10530840
NCBI-ProteinID: XP_003323438
UniProt: E3K3G2
LinkDB All DBs
AA seq 150 aa AA seqDB search
MSPLIFSFPQDYGYVTLAAASTGFLGLFQTMAVGRARKAAKVPYPIAYVSHEEALGDPAK
MKFNCAQRAHANTLESLPFFLFSLLFTGLRHPRFSASCGALWVVGRVFYTLGYNTGDPAK
RSRGVFHNFGTLGLLLGSTWVSLQMVMETF
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctttgatcttcagtttccctcaggattacgggtatgtcacccttgcagcagcg
tctactggatttctaggcttgttccaaaccatggccgtaggcagggcgcgcaaggcagcc
aaagtgccgtacccgatcgcctatgtctctcacgaggaggcgcttggcgacccagctaag
atgaaattcaattgtgctcaacgcgcacatgccaacaccttagaatcgttaccctttttc
ctgttcagtctgctatttactggcctcagacaccctcgtttttcagccagctgtggtgcg
ctatgggtcgttggtcgagttttctatactctaggttacaacactggagaccctgctaaa
cgatcccgaggtgtattccataatttcgggactctaggtcttttgttaggctctacttgg
gtgtcattacaaatggtgatggagactttttga

DBGET integrated database retrieval system