KEGG   Puccinia graminis: PGTG_06908Help
Entry
PGTG_06908        CDS       T02226                                 

Definition
(RefSeq) double-strand break repair protein MRE11
  KO
K10865  double-strand break repair protein MRE11
Organism
pgr  Puccinia graminis
Pathway
pgr03440  Homologous recombination
pgr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    PGTG_06908
   03450 Non-homologous end-joining
    PGTG_06908
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pgr03032]
    PGTG_06908
   03400 DNA repair and recombination proteins [BR:pgr03400]
    PGTG_06908
DNA replication proteins [BR:pgr03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     PGTG_06908
DNA repair and recombination proteins [BR:pgr03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     PGTG_06908
    BRCA1-C complex
     PGTG_06908
   NHEJ (non-homologous end-joining)
    MRX complex
     PGTG_06908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 10536856
NCBI-ProteinID: XP_003325706
UniProt: E3KAD0
LinkDB All DBs
AA seq 735 aa AA seqDB search
MSDEEEQPLNGTLNLTNPCLPTPSITNKDDANTIKILVATDNHIGYAESDPIRGQDSINT
FREILQLAVDHEVDMLLLAGDLFHENRPSRASLYSTIASLREYCLNDRPVRIELIGDSGI
GIPHSFNFPPVNYEDRNLNVGLPVFSIHGNHDDPQGMGPEGALCALDVLSASGLINYFGR
QELPGGAQRDEEALEEGLHIQPVLLQKGRTRLAMYGIGNIRDERFNYEMRSNRIRMSRPA
EFKEQWFNLMLVHQNRVAHGPKNFVPEDGFGDDIDLVIWGHEHDCLITPQEIPGKGYFIT
QPGSSVATSLAKGESIKKHVGILEVQDKDFSLLPIPLKSVRPFIFDDIVLAEHEEEAKLK
LDEKPKVVRYLKSLVEQLIKKATTDWNDEHDYDPDSPPMMLPLIRLRVEYSRADGLSAYD
VGNPQRFGQDFLGKVANPKDLVQFYRRRKIGPRKPKNDIDLPEEEEIEDSQAKAPEKVQV
ATLVHQYLEAQNLGVLAENGMQRAVTLFVEKDDKDAIKEFYHNALEATQAHVKGSKADIG
GSRQDRNPESEDEELLGELTKAKESYADTWEKNQKDELTTQKGKGKAVRKAKRNDDDSDE
SDFGKMSDVRYVDESDNGDPAGQSDSDISIRASVAPKKKAPAKAAPVKKAPAKKAAPAAK
APPKRAATKTAATSSRSRAAASQSQTTLDFSQQAPLRGASRRTAASQSNPQMVSDDSDDS
IEVSTQRKTASRSRR
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgaagaggaacagccgctgaatggcacacttaatttaaccaatccatgtctc
ccaaccccaagcatcaccaacaaagacgacgcgaatactatcaagatattagtggccacc
gataatcacatagggtacgctgaatcagatcccatcagaggtcaagattccatcaacaca
ttccgggaaatcctgcagttggctgttgaccatgaagttgatatgctcttactagctggc
gatctatttcacgaaaatcggccttcaagagcttcattatactcaacaatagcctctcta
agagaatactgcttaaatgatcgaccggttcggattgaactaatcggcgattccggtatc
ggaatcccacacagcttcaactttcctcccgtgaattatgaagacagaaacctcaatgtt
ggcttacccgtgttttcaatccatggtaatcacgatgatccacagggaatgggaccggaa
ggcgctctctgtgctttggatgttttgtcggcgtctggactgatcaattactttggccga
caagagctacctgggggcgctcaaagagacgaagaagcgttggaagaaggcttacacata
cagcctgtcttactacagaaaggaaggactcgtttggcgatgtacggaatcggcaacatt
cgagacgagcggtttaactatgagatgcgtagtaatcggattcgcatgtcgaggccagcc
gaatttaaggaacaatggttcaacctcatgttggtacatcaaaaccgcgtcgcacacgga
ccaaaaaactttgtaccggaagatggatttggcgacgacatagacttggtaatctggggc
cacgagcatgattgtctaattactccccaagaaattccagggaaaggttactttatcacg
cagcccggatctagcgtagcgacaagtttggccaaaggcgaatccatcaaaaaacatgtc
gggattctggaagtgcaagacaaggatttctctctgcttccgatccctctgaaatctgtt
aggccatttattttcgacgacattgttctagctgaacacgaagaagaggccaagctcaag
cttgacgagaagcccaaagttgtccgatatctcaagtcattggtagagcaattgatcaag
aaagcgacaactgactggaatgatgaacacgattatgatccggattcgcccccaatgatg
ttacctttgataagactgagagttgaatattcccgcgcagacgggctgtcggcctacgat
gtcgggaaccctcagcgatttggacaagatttcttgggcaaagtggcgaatccaaaagac
ttggtacaattctatcgacgtagaaagatcggcccgcgcaaaccgaagaatgatattgac
ttgccggaggaagaggaaattgaagactctcaagcaaaggcgccggaaaaagttcaggtt
gcaactttggttcatcaatacttggaggcccagaatttgggcgtactggcagaaaatggc
atgcaaagagctgtcacattatttgtggagaaagatgataaggatgccatcaaggagttt
taccacaacgcacttgaagcgacccaggcccatgtcaagggttctaaagcagatatcgga
ggtagccgccaggatagaaatcctgaaagtgaggacgaagagcttctcggggagctaaca
aaagcaaaagaaagctacgccgacacatgggaaaaaaatcaaaaagatgaacttacaaca
cagaaaggcaaaggaaaagctgtccgcaaggcaaagcgaaacgacgatgattctgatgaa
agtgattttgggaaaatgtcagatgtccggtatgttgatgaatctgataatggcgaccct
gccggacagtccgattccgatatcagtatccgtgcctccgtggccccgaaaaaaaaggca
ccagccaaggcggcaccggtgaaaaaagcgccagccaaaaaagccgcgccagcagcaaag
gcacctcctaaacgcgcagctaccaaaaccgccgctacatctagtcggagtagagctgcc
gcatctcaatcacagactacattggatttctctcaacaagccccgctgcgaggcgctagt
agacgtactgctgcctcccaaagtaaccctcaaatggtgtcggatgatagcgatgatagt
attgaagtttccacccaacgaaagaccgccagtcgatctcgtcgctaa

DBGET integrated database retrieval system