KEGG   Puccinia graminis: PGTG_07517Help
Entry
PGTG_07517        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
pgr  Puccinia graminis
Pathway
pgr00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    PGTG_07517
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pgr01003]
    PGTG_07517
Enzymes [BR:pgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     PGTG_07517
Glycosyltransferases [BR:pgr01003]
 Glycan extension
  Yeast mannan chain
   PGTG_07517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 10534651
NCBI-ProteinID: XP_003326539
UniProt: E3KDA5
LinkDB All DBs
AA seq 457 aa AA seqDB search
MTTGSWTSLSWKDLGTPCTTTHHSRTLHWGRRRASFRSLRRWLLTLSLSAGVVIYLCYTD
SETPSEGFSATYLPRTRALLENWRHSETRDGRWLSVNDGLQPSFTTDPSGIKFPPEVYPA
LMNPYQRANATFVSVVRERDLSDLMISMRTVEDRINRKFGYPWVFLSEDPFSLDFRLAIK
SMTRSQVFFGLIPPRQLSYPSHVDRRRATRVQKTMDNDSQKSRHGDNQSRRHISRFHSGF
FFRHPLMLKFNYYWRVEPGIQYYCDVDYDPFVFMEENKKVYSFSVSLMEYQSTIPSLWKT
VQGFVRANPDLLAANSSIDFLLKDPSQGIESDYNLCHFWSNFEVGDMRFWRSTTYAKFFA
HLDRAGGIYYERWAEGPIHSIAAALFLRREQIHQWDDIGYFQTPFSHCPSDYERFHSNGK
CFCDPFENFDQDPYSCAPLWWELDRKKIKDSKIRSNS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgggttcctggacgagcttgagctggaaagatctcggaacgccttgcaccacg
acgcaccactcacgcactcttcattggggccggcgccgggcgagtttccggagtctgcga
cgctggctcttgaccctatctttatcggcgggcgtggttatatatctgtgttacaccgat
agcgagacgccgagcgaagggttttcagcgacttacctgccccgaacacgtgccctactc
gaaaactggcgacactcagaaacacgtgacggccgctggctctctgttaacgatggcctc
caacccagcttcacgaccgatccgagcgggatcaagttccctcccgaggtctatcccgct
ctgatgaatccttatcagagggccaatgctacttttgtctccgtcgtcagagagcgtgat
ctcagcgacttgatgataagcatgcggaccgtcgaggatcgaattaatcggaagtttggt
tacccttgggtcttcctaagtgaagatcctttcagtctagatttcagactggcaatcaaa
tcgatgaccaggtcccaggttttcttcggcctcatccctccccgccaactgtcttatcct
tcccatgtggaccgacgtagagctacaagggtccaaaagactatggacaatgactctcaa
aagagcagacatggagataatcagagtcgccgacatatttcgcgcttccattcgggcttc
ttctttcgtcacccgctcatgttgaaatttaattactattggcgggtcgaacctgggatt
caatactattgcgatgtggactatgatccatttgtatttatggaggagaacaagaaagtg
tactcattctcagtctctctgatggagtaccaatcgacgatcccgagcctttggaaaacc
gtccaaggatttgtgcgcgccaatccggacctcctagcagcgaatagttcgattgacttt
ctcctcaaggacccatctcaagggatcgaatcagactacaacctgtgtcacttctggtcg
aactttgaggtaggagacatgcgtttctggagatcgaccacctatgccaagttttttgct
catctcgatagggccggggggatttactatgagcgatgggccgagggcccgatccattcg
atcgccgccgcactcttcctccgccgggagcagattcatcagtgggacgacatcgggtac
ttccagacccccttctctcactgtccttccgactacgaacgcttccattcaaacggtaag
tgcttctgtgatccgttcgaaaacttcgatcaggacccttatagctgtgctcctttgtgg
tgggaacttgataggaagaaaattaaggactcaaaaatccgatctaattcatga

DBGET integrated database retrieval system