KEGG   Puccinia graminis: PGTG_07651Help
Entry
PGTG_07651        CDS       T02226                                 

Definition
(RefSeq) glycogen [starch] synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pgr  Puccinia graminis
Pathway
pgr00500  Starch and sucrose metabolism
pgr01100  Metabolic pathways
Module
pgr_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PGTG_07651
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pgr01003]
    PGTG_07651
Enzymes [BR:pgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PGTG_07651
Glycosyltransferases [BR:pgr01003]
 Polysaccharide
  Storage polysaccharide
   PGTG_07651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_5 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 10529627
NCBI-ProteinID: XP_003326673
UniProt: E3KCW8
LinkDB All DBs
AA seq 742 aa AA seqDB search
MSAPVRDVHNHLLFEVAWEVANKVGGIYTVIKTKAPVTCHEYGDRYCLLGPLAYKSAPME
VEAIEPDTPEMRDSLQSMKERGVKYLYGRWLIEGGPRVLLFDTGSMMSRLDEWKTDLWNL
AGIPAPPNDSETNDTIVFGYLVAWFLGEFASRETSKAIIGHFHEWLAGLAIPLCRKRQID
ITTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCVERASTHCADVFTT
VSHITAYESEHLLKRKPDGVLPNGLNVVKFSAMHEFQNIHAISKQKIHDFVRGHFYGHYD
FDLDNTLYFFTAGRYEYRNKGVDMFIESLARLNHKLKTMKSKITVVAFIIMPAATHSYTI
EALKGQAVTKQLRDTVTEIQNRIGNRLFEMTARYTGEIGTEVPDPSTLLSSEDKILLKRR
VFALKRNSLPPVVTHNMADDSADPILNQIRRVQLFNGSHDRVKVIFHPEFLNSNNPILGL
DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCFMDELIENPHEYGIY
IVDRRMKSVEDSVNQLTDQMLEFCTKTRRQRINQRNRTERLSDLLDWKSLGLEYSKARQL
ALRRAYPDSFTAEDSEFESSSAKIGAPFSAPGSPRYRSGAMTPGDIGTLTEDLEGLGTSD
YMGNARWDSTSSGNRDEDSYPFPLVMKRRTGSVGGPSGQSTPGANGNPLNGPGSQASTAA
AGKERLLSEGDLKKADEALVNC
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccccagtcagggatgttcataaccatcttctctttgaggttgcatgggaagtc
gccaacaaagtcggagggatctacactgtcatcaagaccaaggcaccagtgacctgccat
gagtatggtgaccgatattgcctcttgggcccgctggcttataaatcggctccgatggaa
gtagaggctatcgagcctgacacgcccgagatgagagactcgctccagtcgatgaaggag
cgtggggtcaagtatctctacggacgttggttgatcgagggcggccccagagtcttactc
ttcgacaccggctccatgatgtctcggctagatgaatggaagaccgacttgtggaacctc
gccgggatcccggcgcccccaaacgacagtgaaactaacgacacaatcgtcttcggctac
ttggtagcgtggtttttgggtgaattcgcctcccgggaaacttccaaggcgatcatcgga
cacttccatgagtggcttgctgggctcgccatccctctttgccgcaagcgtcaaatcgac
atcaccacgatttttacgactcacgccacccttctaggccgttacctctgtgctggatcc
gtggatttctataacaatcttcagtattttgacgtggatcacgaagccggtaaaagagga
atctatcacagatactgtgtcgagcgcgcctcaacacattgtgcggatgtctttacgacg
gtttctcatatcactgcatacgaaagtgaacatttgctcaagaggaagcctgatggagtg
ctgcccaatggattgaatgtagtcaagttttcagcaatgcacgaattccaaaacattcat
gctatctcgaagcaaaagattcatgatttcgtgcgcggacacttctatggccattatgat
ttcgacttggataatacactttacttctttacggccgggcggtacgagtaccgtaacaaa
ggagtggatatgtttatcgaatctcttgctcgtctcaaccataaactcaagacgatgaag
tccaaaatcacagtcgtggcgtttatcattatgccagcagcgactcattcctacacaatt
gaggctctcaaaggccaagcggttaccaagcaactccgagacacagtgactgaaatccaa
aaccgaatcggcaacagattgttcgaaatgacggcacggtacactggcgagattgggacg
gaagtgcccgacccatcgactctactctcttccgaagacaagatcttgttgaaacgtcga
gtctttgctctcaagcggaactcccttccaccggttgtcactcacaacatggccgatgat
agtgcagaccctatcctcaatcaaatccgtcgcgttcaactcttcaatggtagtcacgat
cgcgtgaaagtcatcttccatccagagttcttgaactctaataatcccatcctcggcttg
gattacgaggaatttgtgcggggatgtcacttgggtgtattcccatcatactatgaacct
tgggggtacactccagccgaatgtactgtcatgggagtacccagcataacaacaaacttg
tctggttttggttgtttcatggacgagttgatagaaaacccccatgaatacgggatttat
attgtcgatcgacggatgaagtcagtggaggactcagtgaatcaactgactgatcagatg
ttagaattctgcaccaagactcgccgacaaaggatcaaccaacgtaaccggaccgaaaga
ctctcggatctcttggactggaagtcgctcggattggagtattctaaggctcgacagctg
gcgctcagaagagcgtatccagacagctttactgccgaagatagtgagttcgaatcaagt
tcggctaagattggtgcgcccttcagcgcccctgggagtccaaggtatagatcaggagcc
atgactcctggtgacattggcacgcttactgaggatctggaggggcttgggacgtcagac
tacatgggaaatgcgcgttgggattctacgtcgagtggcaaccgtgacgaagatagctac
ccattccccttggtgatgaagcgcaggactggctcggtcggcggtccgtctggtcaaagt
acaccaggcgccaatggcaatccgctcaatgggccgggcagtcaagcaagtacggcggcc
gctggcaaagagaggttgttgagcgagggcgacctcaagaaggccgatgaagctttggtc
aactgttaa

DBGET integrated database retrieval system