KEGG   Puccinia graminis: PGTG_07695Help
Entry
PGTG_07695        CDS       T02226                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pgr  Puccinia graminis
Pathway
pgr00250  Alanine, aspartate and glutamate metabolism
pgr00410  beta-Alanine metabolism
pgr00430  Taurine and hypotaurine metabolism
pgr00650  Butanoate metabolism
pgr01100  Metabolic pathways
pgr01110  Biosynthesis of secondary metabolites
Module
pgr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PGTG_07695
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PGTG_07695
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PGTG_07695
   00430 Taurine and hypotaurine metabolism
    PGTG_07695
Enzymes [BR:pgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PGTG_07695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 10529671
NCBI-ProteinID: XP_003326717
UniProt: E3KD60
LinkDB All DBs
AA seq 535 aa AA seqDB search
MSLSKHVKPEQLLQSVKEHGHKTVHGDHHENISTPYSSRYASREIPKFKLPSKGIEPDTA
YQLIHDILDLDGRENANLASFVHTWAPKQAIQLCVENLGKNLIDQDEYPQTQILHTRCIS
MLAHLWHAHNSSNAIGTATTGSSEAIQLGGLAMKKIWQAKRKAAGKSIHEPGPNIVMGAN
AQVALEKFARYFDVEMRLVPVSEKTNYCLDPIKAMEYVDENTIGVFVILGSTYTGHFEPV
KPLSDLLDAYEAKTGISVPIHVDGASGAFIAPFVYPDLPWDFRLPRVVSINTSGHKFGLT
YVGCGWVVWRDQAHLPKELIFELHYLGSVEYSFSLNFSRPAHPIIHQYYNFVQLGFEGYR
AIGLDDLANARLLSRALERSRYYKVLSDIHRKKADMQKPRDQVFGESGLKFEEYVMGLPV
VAFCWTDEFKKKHPHLKQSWVQTLLRAHAWIVPNYELPPDLEDLQILRVVVRESMSPELV
DRLFCSIIEITECLIKEGGPGNFLDAVPKGKSHEHAFGNHQREDATKPVGYARPC
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtctctatccaaacatgtcaagccggagcagctgcttcagtctgtcaaagaacatggc
cataaaacggtgcacggcgatcaccatgagaatatctcaactccttactcctctcgatat
gcttctcgagagataccaaagttcaaattgccttcgaaaggaattgagccagacacagct
tatcaactaatccatgatattcttgatctagatggcagagaaaatgccaacttggccagt
tttgtccacacctgggctccaaagcaagccatacaactctgcgttgaaaacttggggaaa
aatttgatcgatcaggatgagtaccctcaaactcagatcctccacacgcgttgtatttca
atgcttgcccatctctggcacgctcacaattcatcaaacgcaataggaactgctactact
ggctcttcggaagccattcaactcggaggtttggctatgaagaaaatatggcaggccaag
cgcaaagcagccggaaagtccatccacgaaccagggccgaacatcgtgatgggtgccaat
gcgcaggtagctttggaaaaatttgccagatactttgatgtggagatgagattggttccc
gtttccgagaaaaccaactattgccttgaccccataaaagccatggaatatgtagatgaa
aacaccattggcgtgtttgtgatactcggtagcacttacaccggtcactttgagccagta
aagccgctctctgacctgctcgatgcatacgaagccaaaacgggaatctccgttccgatt
catgtggatggagcatcgggggcttttatcgcaccatttgtttaccccgatcttccgtgg
gattttaggctaccacgcgttgtctcaataaatacctcaggacacaaatttggtctcact
tacgttggatgtggctgggtcgtttggcgagaccaggctcacttgccaaaggagctgatc
tttgagcttcactatcttggatcggtcgaatactctttttcgctcaacttttcgagaccg
gcgcacccaattattcaccagtattacaacttcgttcaacttggtttcgagggctatcgg
gcgattggtctggatgatctggctaatgccagattgttatctcgagcgctagagcgaagt
cgttactacaaagtgctgtccgacatccacagaaagaaagccgacatgcaaaagccaaga
gatcaggtttttggggagtcaggcctcaagtttgaggaatatgtgatgggcttgcctgtt
gtagctttttgttggaccgatgaattcaagaaaaagcatccacacttgaagcaatcatgg
gttcaaacattactgcgagcgcacgcatggatcgtacccaattatgagttgcctccggat
ctggaagacttgcaaattttgagagtcgttgttcgcgagtctatgtcaccagagcttgtc
gatcgtcttttctgttcgatcatcgaaataacggaatgcttgatcaaagaaggaggccca
gggaacttcttagatgccgttccaaaaggtaaatcgcatgaacacgcctttggaaaccat
cagcgcgaggacgcaaccaagccagtaggttatgcaagaccttgctag

DBGET integrated database retrieval system