KEGG   Puccinia graminis: PGTG_09482Help
Entry
PGTG_09482        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pgr  Puccinia graminis
Pathway
pgr00730  Thiamine metabolism
pgr00790  Folate biosynthesis
pgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PGTG_09482
   00790 Folate biosynthesis
    PGTG_09482
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgr04147]
    PGTG_09482
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pgr00537]
    PGTG_09482
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PGTG_09482
Exosome [BR:pgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGTG_09482
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pgr00537]
 Enzymes
  PGTG_09482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 10532456
NCBI-ProteinID: XP_003328188
UniProt: E3KHJ4
LinkDB All DBs
AA seq 679 aa AA seqDB search
MRYSSPVPLQPVQDQQYKDNDQTEDRRDEDQDEEDERLDELDELDKLHTTSNSFLPLSRQ
PASPSAQYDPKHSDYQDYRSTKEPLSLHPIQLEGGQEEALITPQPHRTHSLQYKPPAHTK
RVLFFGTSALIGLAYMIVFFATQGTRYGHSLKINVILMISDGFGPASEGFARGFVQHLQN
LTLEQQAQYARWTFPETKTSFQPPLKRPDGPSKNRFGPLPLDPLLVGSSRTRSSNSLITD
SAAGATAFSCALKTYNGAIAVEPVDQKPCGTVLEAAKHRGYLTGLVATSRITHATPASFY
AHVIDRDMESQIATFLTGEGPLGRSVDLAFGGGRRFFLPSSSLTSSRGDDNDLLETAQSK
HGFTIINSTEAFEKAWNPSSRKGHFKTPVLGLFNDNHMNYEIDRISLEGTDKREPSLRNM
SLAALQTLSREAKDKSAHGFFLMIEGSRIDMAAHSNDPVGHLYDILAYQETVRTVQSWVD
EANKAGWPTLMISVSDHETGGLALGRQLTEKYPVYAWYPEVLANASHSTAWLAKKISLSH
QPSQPISRQFIVDEVLKDGLGIIDASDEEIDKLVSLGGRQNVDYLLADMISRRAQVGWST
HGHSGVDVNLYSYPPDLTKELFGNRENTEIGQFIVDAMEIDLDIVTRDLNRLAKSWHVTD
EKHNPNFQNIQLKHYSHEF
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgcgctactcatccccagtcccactccaaccagtacaagaccagcagtacaaggacaac
gatcagacagaagacagacgagacgaagatcaggatgaggaagatgaacgactggacgaa
ctggacgagctcgacaaactccacacgacctccaactcattcctaccgctctctcgccag
ccagcctcgccctcagcccaatatgaccccaagcactcagactatcaggactatcgatca
accaaagaacccctcagcctccatccaatccagctcgaaggcggccaggaggaagcctta
ataacaccgcagccacatcgcactcactccttacagtacaaaccacctgcacacaccaaa
cgggtcctcttctttggcacctctgccttgatcggactggcctacatgatcgtcttcttc
gccacccaaggcacccgctacggccattcgctcaagatcaatgtgatcctcatgatctca
gatgggttcggaccggcctctgaaggcttcgcccggggcttcgtccaacatctgcagaac
ctcaccctcgaacaacaggcccaatacgcccgttggacgttccccgaaactaagacttcc
tttcaaccccctctcaaacgacccgacgggccttccaaaaatcggtttgggcctctgccc
ttggatcctctcctcgttggcagttctagaacaagaagtagtaattccttgataaccgat
tcggctgctggagctaccgcattttcatgtgctttgaaaacatataatggtgcgattgct
gttgaacctgtggaccagaaaccctgtgggacggttctggaagctgccaaacatcgaggt
tatttgactggattggtggccacgtcgcgaatcacgcatgcgacgccagcctcattctat
gcacacgtgatagaccgggatatggagagccagatagcgacgtttctgacgggcgaaggg
cctctaggacgcagcgtcgacctagccttcggaggcggccgccgattcttcctgcccagc
tcgagcctcacctcgtctcggggagacgataacgatctcctggagaccgcccaatctaag
catggcttcacgatcatcaactcgaccgaggccttcgagaaggcctggaaccctagctcc
cgtaagggacacttcaagacccccgtgctcggactctttaacgataatcacatgaactat
gagatcgatcggatcagcttggaagggactgacaagcgagaaccttcgcttaggaatatg
tctttggccgcactacagaccctgtcaagggaagccaaggacaagtccgcccatggtttt
ttcttaatgatcgaaggatctcggattgacatggctgcacattcaaacgatccggtaggc
catctgtacgatattttggcctatcaggaaaccgttaggacagttcaaagctgggttgat
gaggcgaacaaagccggctggccaacgttaatgatctcagtgtcggaccacgaaacgggt
ggactagcgttaggtcgccagttgacggagaagtatccggtgtatgcatggtatccggaa
gtcttggccaacgcgagccactcgaccgcctggctggcaaagaagatctcgctctctcac
cagccctctcagccgatctcccggcaattcatcgtcgacgaagtcctcaaggacggtctg
ggaatcatcgacgcctcggatgaggagatcgacaaattggtctccttgggtggccgccag
aacgtagattatctcttggctgatatgatttcccggagagctcaagtcgggtggtctact
catggtcattcgggtgtcgacgtaaatctatacagttatccccccgatctcaccaaagaa
ctcttcgggaatcgtgaaaatactgagatcggacagttcattgtggatgcaatggaaatc
gatcttgatattgttactcgtgacctgaatcggttggctaagtcttggcatgtcactgat
gagaagcataatcccaactttcaaaatatccaattaaagcattattcacatgagttttga

DBGET integrated database retrieval system