KEGG   Puccinia graminis: PGTG_10848Help
Entry
PGTG_10848        CDS       T02226                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pgr  Puccinia graminis
Pathway
pgr00020  Citrate cycle (TCA cycle)
pgr00190  Oxidative phosphorylation
pgr01100  Metabolic pathways
pgr01110  Biosynthesis of secondary metabolites
pgr01130  Biosynthesis of antibiotics
pgr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PGTG_10848
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PGTG_10848
Enzymes [BR:pgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PGTG_10848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 Lycopene_cycl HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 10526656
NCBI-ProteinID: XP_003329108
UniProt: E3KK64
LinkDB All DBs
AA seq 650 aa AA seqDB search
MLRSKATSLLSRVKPSPTPLANRTFSSSSSRSRIISTQPVKASETSAKFSNGKYPIIDHE
YDAIVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRW
HMYDTVKGSDWLGDQDAIHYMCKEAPQAVIELEHFGVPFSRTKEGKIYQRAFGGQSLKYG
KGGQAYRCAAAADRTGHAILHTLYGQSLRHNTNFFVEFFALDLIMDDAGNCVGVTAYNQE
DGTLHRFRAHQTVLATGGYGRAYFSCTSAHTCSGDGNAMVTRAGLPLQDLEFVQFHPTGI
YGAGCLITEGSRGEGGYLLNSQGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPD
KDHCYLQLSHLPPEVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGQ
VLTQDPKTGADKIVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAKHISANMEPG
KPHKAMSEDAGMKSIEDLDKLRNASGPKPTAQIRNDMQRVMQNDAAVFRTQSSLEEGVQK
IHKVVDSFKDVGVTDRSMIWNTDLVETLELRNLLTCAAQTMSSAEARKESRGAHAREDFP
EREDDSWMKHTLSWHNPESGEPVKLTYRDVISSTLDENECKSVPPFKRTY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgctacgctccaaggccacctcactactctcaagagtcaaaccaagcccaactccactc
gccaatcgcaccttctcaagcagctcatcacgctcccggatcatctccacccaacccgtc
aaggcttccgagacaagcgcaaagttctccaacggcaagtacccgatcatcgaccacgag
tacgatgccatcgtcgtcggagccggtggtgccgggctcagggctgccttcggactcgcc
gaggccggcctcaacacggcttgtatcaccaaactcttcccaacccggtcccacacagtg
gccgcccagggtggggtcaacgctgcactaggaaacatgacagaggatgattggcgttgg
catatgtacgacaccgtcaagggctctgactggcttggagaccaggacgcgatccattac
atgtgcaaggaagctccacaggcggtaatcgaactcgaacatttcggggtgcccttctcg
cggaccaaggagggaaagatctaccaacgagccttcggaggacaatccttgaagtacggc
aagggaggacaagcctaccgatgtgccgcagccgccgaccgaaccggccatgcaatcctg
cacaccctctacggccaatctctgcgtcacaacaccaacttctttgtcgaatttttcgca
ctcgacttgatcatggatgatgctggtaactgcgtcggtgtgactgcgtataaccaagag
gatggcaccctccaccgattcagagcacaccagaccgtcctggctaccggaggctacggt
cgggcttacttctcttgtactagtgctcacacctgctcgggagacggtaacgccatggtt
acccgggctggattgcccttacaagatctcgaatttgttcaattccatcccaccggaatt
tatggggctggatgtctgatcaccgaaggatctcgaggagagggtggatacttgttgaac
tcacagggagagagattcatggaacgatatgcacccacagctaaagacttggcttctcga
gacgtggtctcacgatcgatgacgatcgagatcagagaaggcagaggtgtcggacccgac
aaggatcactgctaccttcaactctctcatctccccccagaagtcctccacgagcgtctc
cccggaatctctgaaactgctgctatctttgctggtgtcgatgttaccaaggaaccaatt
ccagtcttaccaaccgtgcactacaacatgggaggaattccgacaaactaccacggccag
gttttaactcaagaccctaagacgggagcggacaagattgtaccgggactgtatgcagcg
ggagaggcggcatgtgtgtctgttcacggcgcgaacagactaggagccaactcgctgttg
gacatcgtagtcttcgggcgtgcatgtgcgaagcacatctcagcgaacatggaaccaggc
aagcctcacaaggcgatgtccgaggacgcagggatgaagtcgatagaggacctcgacaag
ctcaggaacgccagcggacccaagccaaccgcgcagatccgtaacgacatgcaaagagtc
atgcagaacgacgccgccgtcttccgcacccaatctagcttggaagagggtgtccagaag
atccacaaggttgtcgactccttcaaggacgtcggagtaactgatcgaagtatgatttgg
aacactgatttggtcgagaccttagagctccgaaacttgttgacatgtgcagcccagacg
atgtcttcagctgaagcccgaaaagagtcacgaggcgcgcatgcacgcgaggatttcccg
gaacgagaagacgacagctggatgaaacacactttgtcgtggcataaccctgagtctggt
gagcccgtcaaattgacttaccgggacgtcatcagctctaccttggacgagaatgaatgc
aagagtgttcctccgttcaaacgtacttactaa

DBGET integrated database retrieval system