KEGG   Puccinia graminis: PGTG_12372Help
Entry
PGTG_12372        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
pgr  Puccinia graminis
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pgr03036]
    PGTG_12372
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PGTG_12372
Chromosome and associated proteins [BR:pgr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PGTG_12372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 10540431
NCBI-ProteinID: XP_003330835
UniProt: E3KQ41
LinkDB All DBs
AA seq 720 aa AA seqDB search
MDSARETTPHADPTHQSSTLDSHAARAQPTIHIVTQDECFKHVFRRTKERSTIYERPERL
RFVNLGLAAALAWDSLHYLSPARLLAPATSHEPSITTPLVLTPLVTFTKTTRKLSTLDPA
FAQIHDQPNRPSSPEPASSSDSQAHPDRFASFHASNSYLEQLVGLCLQASELNLLGLSEV
PQHLPQGDLYLSPGSEAAILGSIGACYTAIDSVLKPEPKKEEAEQSPKYKKAFVNIRPPG
HHCTNSEPMGFCWVNNVLIGCMYSYLTYDIDRICIVDIDLHHGNGSQEIVWRINEQVALQ
PESSGKRRLMISYSSLHDINSYPCEDGDPVRIKDASLNICVGNAINQFIQNLHLEDWVDE
SDFFGRLYPKTWQAFEQHMSAFFRISNADPDHSLIFVSAGFDACEHESEDMSRYAKKLPT
SFFNRFARDISRFSEARCHGRLISVLEGGYSERALTGSSLSYMLGLMGRETGAETVGPAW
GGGRLERLIRLCKRTESVRRGQTKGLEEPDVDELAWLTETRRIFEAVDGFGQAQNELKTV
ARREQKQRLLQQNLGLLDARSPDGPRRSQRHASGSKPSPAKPDPHPRHPSAPSKTLPTSP
AIDPPRPAAPPSPSSDHSSPLTSEPESSTDEPPVISTTAPGSSIDNLFSNLQLGPDVRPP
SSPPPHPVSSSSSSTTAAAQQQPQQQLPKLKLVWKAGGVLGTSQNNNQSTTQSGPSDGQK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggattctgcgcgtgagacgactccccatgcggacccaacccaccagtcttcaaccctc
gacagtcatgctgctcgcgcccagccgacgatccacatcgtgacccaggacgaatgcttc
aagcacgtgtttcgccggaccaaggagcgctcgacgatctacgagcggcccgagcggctg
cggttcgtcaacctcggcctcgccgccgccctcgcttgggattccctgcactacctttca
cccgcccgtctgctggccccggctacctctcacgagccctcaatcaccaccccgctcgtc
ctgactcccctcgtcaccttcaccaaaactaccaggaaactctccactctcgatcccgcg
ttcgcgcaaatacacgaccagcctaatcgtccgtcctcccccgaacccgccagctcttcc
gactcgcaagctcatccagatagattcgcttccttccatgcctccaatagctatctagaa
caacttgttggcttgtgtttacaagcctcggaactcaatctgcttggcctatccgaggta
cctcagcatttaccgcaaggagacctttatctttcaccaggcagtgaggcggccatctta
ggctcgatcggcgcctgctatacggccatcgattccgtcctcaaacccgaaccgaagaag
gaggaagctgaacaatccccgaagtacaagaaggcatttgtcaacatccgtccgccgggg
catcattgcacgaactcggagccgatgggcttctgttgggtcaataatgtgctcatcggc
tgcatgtacagttaccttacctacgacatcgaccggatctgcatcgtcgatatcgatctg
catcacgggaacggcagccaggagatcgtctggcgcatcaatgaacaggtcgccctccag
ccggagtcgtcggggaagcgcagactcatgatcagctacagttctctccatgacatcaac
tcctacccctgtgaggacggcgaccccgttagaatcaaggacgcctccctcaatatctgt
gtcggcaacgcgatcaatcagtttatccagaatcttcacctcgaggactgggttgatgag
tcggacttcttcggcagactgtaccccaagacctggcaggctttcgagcaacacatgtcc
gccttcttccggatctcaaacgccgatccagatcattctctgatctttgtcagtgcagga
ttcgatgcgtgcgagcatgagagcgaagatatgtcccgatacgcgaagaagctacccacc
tcgttcttcaaccgatttgcgcgagatatcagtcgattctccgaggcccgttgtcacggc
agactgatatcagtgctcgagggtgggtacagcgagcgggcgttgacggggagcagtctg
agctacatgcttgggctgatgggccgagagactggggccgagacggtagggccggcgtgg
ggtggaggacggttagagcggttgattcggctctgcaaacggacggagtccgtgcgccgg
ggccagacgaagggcttggaggagccggatgttgacgagctggcatggctcacggagacc
cgacggatcttcgaggccgtcgacggcttcggccaggcccagaacgagctcaagaccgtc
gctcgccgcgagcagaaacagcgccttctccagcagaacctcggcctcctcgacgcccgc
tcgcccgacggaccccggcgcagtcaacgccatgccagtggctccaagcctagcccggcc
aagcccgaccctcatccccgccatcccagtgccccctccaagacccttcctaccagccca
gccatcgatcccccacgtcccgcggctcccccgagcccctcttccgatcactcttcccct
ctcacatccgagccggaatcttcgactgatgaacctcccgtcatatctactaccgctccc
ggctcatccatcgacaacttgttctccaatctccaactcggacctgacgtccgtcctcct
tcttctcccccacctcatcccgtctcttcttcttcttcttctactactgctgctgctcaa
caacaaccacaacaacagcttcctaaactcaagcttgtttggaaagccggcggcgtcctc
ggaacgtctcagaacaacaaccaatccaccactcaatcgggtccatctgatggccagaaa
taa

DBGET integrated database retrieval system