KEGG   Puccinia graminis: PGTG_17146Help
Entry
PGTG_17146        CDS       T02226                                 

Definition
(RefSeq) AGC/PKA protein kinase
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pgr  Puccinia graminis
Pathway
pgr04113  Meiosis - yeast
pgr04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    PGTG_17146
  09143 Cell growth and death
   04113 Meiosis - yeast
    PGTG_17146
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pgr01001]
    PGTG_17146
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pgr03019]
    PGTG_17146
   03036 Chromosome and associated proteins [BR:pgr03036]
    PGTG_17146
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PGTG_17146
Protein kinases [BR:pgr01001]
 Serine/threonine kinases: AGC group
  PKA family
   PGTG_17146
Messenger RNA biogenesis [BR:pgr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PGTG_17146
Chromosome and associated proteins [BR:pgr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    PGTG_17146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TFIIA Exonuc_VII_L PAT1
Motif
Other DBs
NCBI-GeneID: 10529037
NCBI-ProteinID: XP_003335708
UniProt: E3L414
LinkDB All DBs
AA seq 483 aa AA seqDB search
MSTFDPMTVNQADLTFNHPPPPKYAPPASTDLPNLVSPMIQPPTPLGPSTPLSHSTTPSS
ANHQLHPQQQQQQQSHLLQQQQLQQYQQHQHQQHELLKQQQQQLKQQQQQLKQQQHELLL
QQQQQPTNPHFPASSPIPVSTPLESNPSSSQASDPTKTPRKTSSRYALADFDLIRTLGTG
SFGRVHLSKSRHNGRGYAIKVLNKKRVVGLKQVEHTNSERQMLAAVRHPFLVNLWGTFAD
SYNLYMVMDFVSGGELFNLLRKSQRFPDPVAKFFGAEVALALDYLHCLDIVYRDLKPENI
LLGSDGHIKITDFGFAKLVPDITWTLCGTPDYLAPEIVQSKGYNKSVDWYALGVLIFEML
AGYPPFYCEEESPMRLYEKIIAGKVRYPSYFNPSAKDLLKSLLTADLSKRFGNLANGSRD
IFHHGWFAEVDWERLYRKQIPAPYVPRVSSEWDASNFDHYDEASLEEYGKVGEDPYGHLF
PGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacctttgaccccatgacagtcaaccaagccgacttgacattcaaccatccacca
ccacccaagtatgcacctcctgcctctactgacttgcccaaccttgtctccccaatgatc
caacctccgactccacttggaccctccactccactgtctcactcaacaacaccatcctcg
gccaaccatcaacttcacccccaacaacaacaacaacaacaatcccacctactccaacaa
caacaactacaacaataccaacaacatcaacaccaacaacacgaactactcaaacaacaa
caacaacaactcaaacaacaacaacaacaactcaaacaacaacaacacgaactactctta
caacaacaacaacaaccaaccaaccctcactttcccgcctcttcacccatacctgtttcc
actcccctagaatccaatcccagtagttctcaagcttccgatccaaccaaaactcctcgc
aagaccagctcgcgttatgcactggccgactttgatctcattcgcaccctcggcactggc
tcattcggtcgagtgcatctctccaaatctcgtcacaacggtagaggttacgcgatcaag
gttttgaataaaaaacgcgtcgtcggtctcaagcaagtcgaacatacaaactcggagcga
cagatgttggctgctgttcgacaccctttcctcgtcaatctctgggggacattcgctgat
tcttacaatctttacatggtcatggacttcgtttctggtggtgaattattcaacctgtta
cgtaagagtcagagatttcccgatccggtggccaaattctttggagccgaagtagccctg
gcactagactacttgcactgtttggatatcgtttatcgagacttgaaaccagagaatatt
ttacttggatcggacggacatatcaagatcaccgattttggattcgccaaacttgtaccg
gatatcacctggaccctttgtgggacacccgattatcttgcccctgaaatagtccagtct
aaggggtacaataagagtgtggattggtatgcacttggggttctgatcttcgaaatgctc
gctggttacccgccgttttattgtgaagaggagagtccgatgaggttgtacgaaaagatc
attgccggcaaagttcggtatccctcatacttcaatccatctgccaaggacctcttgaag
tcgctcctgaccgccgatctatcgaagaggttcggaaacttggccaatggatctcgcgac
atctttcatcatggctggtttgccgaagtggattgggaacgtctctatcgtaaacagatc
ccagcaccttacgttcctcgggttagctcggaatgggacgcttcgaatttcgatcattac
gatgaggcatcacttgaggagtacggcaaagtcggagaggatccttatggtcatctcttc
cccggcttttag

DBGET integrated database retrieval system