KEGG   Puccinia graminis: PGTG_18333Help
Entry
PGTG_18333        CDS       T02226                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pgr  Puccinia graminis
Pathway
pgr00010  Glycolysis / Gluconeogenesis
pgr00051  Fructose and mannose metabolism
pgr00052  Galactose metabolism
pgr00500  Starch and sucrose metabolism
pgr00520  Amino sugar and nucleotide sugar metabolism
pgr01100  Metabolic pathways
pgr01110  Biosynthesis of secondary metabolites
pgr01130  Biosynthesis of antibiotics
pgr01200  Carbon metabolism
Module
pgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pgr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTG_18333
   00051 Fructose and mannose metabolism
    PGTG_18333
   00052 Galactose metabolism
    PGTG_18333
   00500 Starch and sucrose metabolism
    PGTG_18333
   00520 Amino sugar and nucleotide sugar metabolism
    PGTG_18333
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PGTG_18333
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     PGTG_18333
Membrane trafficking [BR:pgr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    PGTG_18333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Staph_haemo
Motif
Other DBs
NCBI-GeneID: 10538010
NCBI-ProteinID: XP_003336765
UniProt: E3L723
LinkDB All DBs
AA seq 485 aa AA seqDB search
MVVVLSLFITRTHDNAQLPHATKMQMADYLRKFEHLFMVTPQRMRMIVEAFIDTLEAGLK
EDGQCVPMIPTFVFGWPTGKEVGPYLAVDLGGTNLRVCHVELQGDGRFEITQAKYKLTDE
QKQQEGEKLFDFCAECLSKFVNDQYVDDDGNLLLDADIPLGFTFSYPCTQKKIDHGELIR
WTKGFGNPNVEGHDVGEIFSKSLKKFKVPVKLTAVINDTTGTLIASSYVDPATRIGVIFG
TGCNAAYMEKVANIPKIASLGLPPDAEMAINCEWGAFDSGTHEHLPRTKYDLVIDETSNK
PGEQAFEKMIAGLYLGEVFRLIVVEMIEEGILFLGQNTYKMEKSYCFDTAFLSLIESDPT
EELLTVTGLFTHFFGLDTTISERQFFRRLAELIGTRSARLSACGIAAIVSKMGMVETGCG
VATDGSLYNKYPQFPQRLHEALVDIFGEKGRLIKTYHAEDGSGVGSAIIAAMTKARLAEG
KFTHV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtggttctatcgttgttcataaccagaacccatgacaatgcccaacttccccat
gcgactaagatgcagatggcggattaccttaggaaattcgaacatcttttcatggtcacc
cctcaacgaatgcgaatgattgtcgaggcatttatcgatacccttgaagcaggtttgaaa
gaggatggacagtgcgttcctatgatacccacatttgtgtttggatggccaaccggcaag
gaagttggcccatacttggccgtggacttgggcggtaccaatttgcgtgtatgtcatgtg
gaactgcagggtgatggcaggtttgaaatcacccaagcaaaatacaaattgacggatgaa
caaaagcaacaagaaggagaaaagttatttgacttttgcgcagaatgtttatccaagttt
gtcaacgatcaatatgttgacgatgatggcaatttgctgttagacgcggatatcccccta
gggttcaccttcagttacccttgcacgcagaagaaaatcgaccatggtgagctcattcgt
tggactaaaggtttcggaaaccccaacgtggaagggcacgatgttggcgagattttttcc
aagtcattaaagaaatttaaagtacccgtcaagctcactgcagtaattaacgacaccact
ggaacgcttattgcgtcttcttacgtcgatccggccaccagaatcggagttatcttcggt
acaggctgcaacgccgcttacatggagaaagtcgcaaatatccccaagatcgcctcactc
ggccttcctccagatgccgagatggctatcaattgtgaatggggggctttcgattctggt
acccatgaacacttgcctcgaaccaagtatgatttggtcatcgatgaaacctctaataag
cctggagaacaagcttttgagaagatgatcgccggcctctatcttggtgaagttttccga
ctgatcgtagtggagatgatcgaagaagggatcttgtttttgggtcagaatacatataag
atggaaaagagctattgtttcgatactgccttcctcagtctgatcgaaagtgaccccaca
gaggaattattgacagtcacagggttatttacacacttctttggcttggataccacgatt
tccgaacgccagtttttccgaagacttgcggaattgataggtaccaggtccgctagactt
tcggcctgtggaatagcggctatagtgtccaagatgggaatggtcgaaaccggatgtgga
gtggctaccgatggaagtctttacaataaatacccacaatttccccaaaggttacacgaa
gctctcgtggatatttttggtgaaaagggccgcttaattaaaacctatcatgccgaagat
ggctccggagtaggaagtgcaataattgcagcgatgaccaaagcaagattggcagagggc
aaattcactcatgtctag

DBGET integrated database retrieval system