KEGG   Puccinia graminis: PGTG_21909Help
Entry
PGTG_21909        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
pgr  Puccinia graminis
Pathway
pgr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PGTG_21909
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pgr03400]
    PGTG_21909
Enzymes [BR:pgr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PGTG_21909
DNA repair and recombination proteins [BR:pgr03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     PGTG_21909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C RNA_ligase BRCT LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 13540747
NCBI-ProteinID: XP_003889352
UniProt: H6QT04
LinkDB All DBs
AA seq 1005 aa AA seqDB search
MTIHIKTEDEDEPELKPVKKEYDHDDPLRPLGPSPSFHDLCRILDAMECRREERVSSLTK
HRPKYLKALFEKWRKVYGNDLYPCIRLLLPKHDRNRPMYFLKEFGLGRLYCDALSLDKKT
SSAAKRLLSWKSGAPNQNNNESSAGDFAKVLYKEIDSRSMVAKTLLSIDDINDQLDSLAT
ARSGAKRLEIVKTWLEKITPKDHLWLLKIILQDLRLGLSESVVLCAFHHNAYEYYNICTD
LKTVCHTLHSTHIPLEDTQASLKTFNVFKPMLSKRSTKDLPDIVKLMLSGKHKEFLIEEK
MDGERIQLHKSGEQYQFWSRSGTNYTDIYGANPTIGCLTPFIHSAFKPAVEDVILDGEML
VWDPKKKRILPFGSVKSLKPSSINRDEPRALFKVFDILYLKGKGKPEGTSLINKPLSERR
QVMESGRVFVEIKTRLEFCYSVRGKDTQDIKASFEKILEESGEGLIIKRLDSKYRVNART
DDWYKVKPDYMDELGETFEVLAVGAFWGRGKRGGTFGSFLVALVDNENSDPLQGIFRYKT
LCRVGTGLTTDETTQIMTKLEGKYSNWDKKRPELNPDWLDIGKGSGQTPDVWWHWKDSFV
LTIKGTEIINSYAYGCQFSIRFPRSIRFDMERDIGDCMPYQELLGIANQLQDKNKLGENL
SGHVRKRKRNELSQPTSSLMPLKRSDSHKIFYGAEFWVLQGLEDTAESKSDLEVMLNRNG
GKIIHTVPRPAPDREHFCITRRTDFWDAEKAIRHGLQLVHPQWVHDSMEAGYKIVVTSPK
YAVNTAQPTVENSISQYTSALAVVKKESDSEGGEDWADEQSDATTVAEDRWPNASATEDG
VSDHDLRDESPQLSHAKIEPSESVTDKPLGCEDVPLPNKPLDTKLEAEVKEGIFYPLVFY
LDNKPIAHSSEGPVGNTVSVDPDGESSKLFSQVSRLLKAHGGRIVSDVNDPDSTHIICSP
TDTSRCVDLRRIDKDRPRRRRLVTADWVLDSVEGDSCLYEADYLP
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccacatcaagacagaagatgaagacgagccggagctcaagccagtgaagaag
gaatacgaccatgatgatcccctacgaccccttggaccttcgccctcgttccacgatttg
tgtagaatactcgatgccatggaatgccgcagggaagagagggtatcgtcccttactaag
catcgtccaaagtatttgaaagcactcttcgagaagtggcgcaaggtatacggtaacgac
ttgtatccttgcatccgactgcttctaccaaaacatgatagaaaccgaccaatgtacttt
ttgaaagaattcggcctgggacgattgtactgtgacgctctaagcttggacaagaaaact
tcatctgccgcaaaacgtctcctgagttggaaaagcggagcccctaaccagaacaacaat
gagtcttcggctggggattttgcaaaagtgctctataaagagatcgatagtcggtccatg
gtcgctaaaactctactctcgattgacgacatcaacgaccagctggattccttagccacg
gcgcgttcaggggcgaagagacttgaaattgtcaaaacgtggctcgaaaaaattactccc
aaagatcacctgtggctactcaagatcatcctccaagatctcaggctagggctcagcgaa
tctgtcgttttatgtgcttttcatcataatgcttacgagtattacaacatttgtaccgac
ctcaagactgtttgtcacacccttcattccacacatattcctctggaagacacacaagct
agtttgaaaactttcaacgtcttcaaaccgatgctttctaaaagaagtacgaaagatcta
ccagatattgtcaagttgatgctctcgggaaagcacaaggagtttttgatcgaagagaag
atggatggtgaacgaatccagctccataagagtggcgaacaatatcaattttggtcaagg
agtggtacaaattatacggatatatatggagccaatcctacgattggctgtctgacgcca
tttattcatagtgcgttcaaaccagcggtcgaagatgttatactggacggggaaatgcta
gtatgggatccgaagaagaaaagaatactgccgtttgggagtgtgaagtccttaaagccg
tcttcgattaaccgggatgaaccacgagccttgttcaaggtgtttgatattttgtatctc
aagggaaaaggcaagcctgagggtacaagtctgattaacaagcctttgtcagaaaggagg
caggtgatggagagtgggagggtctttgtcgagattaaaaccagattggagttttgctat
tccgtgcggggtaaggatacgcaagacatcaaggcgagctttgaaaaaatcttggaagaa
agcggtgaaggattgatcatcaagagacttgattccaaatatcgggtcaacgctcggaca
gatgattggtataaggttaagccagattacatggatgaattaggagaaacttttgaagtt
ttagcagttggagcattctggggacgaggaaagaggggaggcacgtttggtagttttcta
gtcgcattagttgacaatgagaactctgacccattgcaaggaattttccgctataaaacc
ctatgtagagtaggaacaggcctcaccactgacgaaacgacgcagatcatgaccaaactt
gaaggaaagtactccaactgggataagaaaaggccagagctcaaccctgattggttggat
attggcaaaggctcgggacaaactcctgatgtttggtggcactggaaagattcatttgtg
ctcacaataaaaggtaccgaaattatcaattcttatgcctatgggtgtcaattttctatc
cgatttcccagatcaattcggttcgacatggagagagatatcggagattgtatgccttat
caagagctcttgggtatcgcaaaccagttacaggacaagaacaagctcggtgaaaatctc
agtggccatgtgagaaaacgaaaacgaaatgaattatctcagccgacatcttcacttatg
cctctgaagcgcagtgattcccacaagatcttttatggggcggaattctgggtactgcaa
ggtctcgaggacactgctgaaagtaaaagtgatctagaggtaatgctgaaccgcaatggg
ggcaagatcattcacacggtccctcgaccagcacctgatcgtgaacatttttgcattacc
cggagaacagatttttgggatgctgaaaaagcgattcgccacggtttgcaattggtacat
ccacagtgggtccatgactcaatggaagcaggctataagatagttgtcacaagtcccaaa
tacgccgttaacacggcccaacctacagttgaaaattccatctcacagtataccagtgct
ttagcagttgtaaagaaagaaagtgactcggagggtggcgaggactgggctgacgagcag
tctgatgcaaccactgtcgccgaagatcgttggccaaatgcaagcgctactgaggacggg
gtcagtgaccatgatctgcgcgatgagtcgcctcagttgtcacatgcaaagattgaacca
tccgaatctgtaacggacaagcccttgggttgtgaagatgtacccttgccaaacaaacca
ctagatactaaactagaggcggaagtcaaagaaggaatcttctatccacttgtattttac
ttggataataagccgattgcccattcttcagaaggcccggttggtaacactgtatcagtt
gaccccgatggtgaatccagcaaattgttctcccaggtttctcgattacttaaagcacat
ggtggtcgaatcgtatctgacgtgaacgatcccgactcaacacatatcatttgtagtccg
actgatacctccagatgtgttgatctcagaagaatagacaaagatcgcccgagaagacgc
agattagtgacggcggattgggtacttgattcagtcgaaggcgattcttgtttatacgaa
gctgattatttgccatga

DBGET integrated database retrieval system