KEGG   Pedobacter ginsengisoli: CPT03_04700Help
Entry
CPT03_04700       CDS       T05145                                 

Definition
(GenBank) galactose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pgs  Pedobacter ginsengisoli
Pathway
pgs00010  Glycolysis / Gluconeogenesis
pgs00052  Galactose metabolism
pgs01100  Metabolic pathways
pgs01110  Biosynthesis of secondary metabolites
pgs01120  Microbial metabolism in diverse environments
pgs01130  Biosynthesis of antibiotics
Module
pgs_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:pgs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPT03_04700
   00052 Galactose metabolism
    CPT03_04700
Enzymes [BR:pgs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     CPT03_04700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ATP55816
UniProt: A0A2D1U2I1
LinkDB All DBs
Position
1156605..1157774
Genome map
AA seq 389 aa AA seqDB search
MKQTLKPGLAAIFLLAITACNEPKKVNETTEQADTTATTVQLDSTKFQKEIDGKKTNLYV
LKNKNNVQAAFTNYGGRLVSLLVPDKDGKLVDVVVGFDSVDGFVNSSEPYFGATIGRYGN
RIAKGKFSLDGKQYTLALNNGQNTLHGGKKGFQAVVWDAAMPDSQTLVLTYLSKDMEEGY
PGNLKVKVTYSLNDDNELKMDYEATTDKKTVVNLTNHAFFNLNGEGSGDILNHDLQIFAD
LYTPVDTTLIPLGKNVTVKGTPFDFTTATTIGKRIEEANDQLKAGKGYDHNFVLNGTKGL
GMTHAATVKGDKSGVIMDIYTQEPGLQFYSGNFMQSKNVFKGGAKDDFRTALALETQHFP
DSPNQPAFPSTVLNPGQTYKTTSIYKFSK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaacattaaaaccgggcttagctgcaatatttttacttgcaattacagcatgt
aatgagccaaaaaaggttaatgaaactactgagcaagctgatactactgctacaaccgtt
cagttagatagtacaaaattccaaaaggaaattgatggtaaaaaaaccaatctgtatgtg
cttaaaaataaaaacaatgtacaggcagcatttaccaattatggtggcaggctggtgagt
ttactagtgccagataaggatggtaaactggttgatgtggtagttgggtttgatagtgtt
gatgggtttgtgaattcgtctgagccatattttggtgctacaattggtcgttatggcaac
agaattgccaaaggcaaattcagtcttgatggcaaacaatatactttggcactcaataac
ggccaaaataccttacatggtggtaaaaaaggatttcaggctgtagtttgggatgctgcc
atgcctgattcgcaaacgctggtacttacttacctgtcaaaagacatggaagagggctac
cctggaaaccttaaagtaaaggttacttatagccttaacgatgataatgaactgaaaatg
gattatgaggctactactgataagaaaactgtggttaaccttaccaatcatgctttcttt
aacctgaatggagagggtagtggcgatattttaaaccacgacttgcagatctttgcagat
ctttatactccggttgatactactttaatccctctgggtaaaaatgtaactgtaaaaggt
actccgtttgattttacaactgctaccactattggtaaacgcattgaagaggcaaacgat
cagttaaaagcaggtaaaggttatgatcataactttgtgttaaatggcaccaaaggtctg
ggtatgactcacgctgctactgtaaaaggtgataaatcgggcgtgataatggatatttat
actcaggagcctggcttacagttttatagcggcaactttatgcaaagcaaaaatgtattt
aaaggtggtgcaaaagatgattttagaacagcacttgccttggaaactcaacactttcct
gactctccgaatcagccggcttttccatcaacggttttaaaccccgggcaaacgtataaa
acaacttctatttacaagtttagtaaatag

DBGET integrated database retrieval system