KEGG   Pedobacter ginsengisoli: CPT03_06765Help
Entry
CPT03_06765       CDS       T05145                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pgs  Pedobacter ginsengisoli
Brite
Enzymes [BR:pgs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CPT03_06765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Thiol_cytolys_C
Motif
Other DBs
NCBI-ProteinID: ATP56189
UniProt: A0A2D1U3K9
LinkDB All DBs
Position
complement(1654978..1655505)
Genome map
AA seq 175 aa AA seqDB search
MKNFLTVAIITIMAFFTSCSTTAEVEVAEAKLATTADAKDIGVAKFYKLKDGKMKMDLEL
NFPARADSTVAVHFHEHGDCGDMGNNTHGHWNPTNEAHGKWGSAAYHSGDIGNIQLDSKG
HGTISVTTDRWSIEENDIKNIINRGIIVHGGTDDYTTQPTGNSGPRVGCGVIVKL
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttttaacagtagctattattacaataatggcattttttacttcctgctca
actactgcagaagttgaagtagcagaagcaaaactggcaacaaccgctgatgcaaaagac
atcggagtagcaaaattctataagttaaaagatgggaagatgaagatggatttagagctt
aattttcctgcccgtgctgatagtactgttgcagtgcattttcatgagcacggagattgt
ggcgacatgggcaataatacgcatggccattggaatcccactaatgaagctcatggtaaa
tggggatctgcagcatatcattcaggagatattggaaatatccaattagacagtaaaggt
cacggtactatatcggttactaccgaccgttggagtattgaagaaaatgatatcaaaaat
ataattaacagaggtattatagttcacggaggtacagacgattatactacccagcctaca
ggaaattcaggacctagagttggatgtggtgtaattgttaaactttaa

DBGET integrated database retrieval system