KEGG   Pedobacter ginsengisoli: CPT03_07335Help
Entry
CPT03_07335       CDS       T05145                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pgs  Pedobacter ginsengisoli
Pathway
pgs03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pgs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CPT03_07335 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pgs03400]
    CPT03_07335 (ligD)
Enzymes [BR:pgs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CPT03_07335 (ligD)
DNA repair and recombination proteins [BR:pgs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CPT03_07335 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme GH3
Motif
Other DBs
NCBI-ProteinID: ATP56297
UniProt: A0A2D1U3V8
LinkDB All DBs
Position
1787743..1790277
Genome map
AA seq 844 aa AA seqDB search
MSLKEYGKKRDFNKTAEPKAIKTKSTGKLHFVIQKHDASRLHYDFRLEMEGVLKSWAVPK
GPSTDPKTKRLAVMVEDHPFDYKNFEGIIPKGEYGGGTVIVWDEGTYEPIEKVKGKKAQE
KYLLNQLHDGSLKIILHGKKLKGEYALVKTQGMGENGWLLIKHKDEYASLVDITKKDTSV
LSSQTIEQVKKAKVTEVSAEVNTLLKKGKKSKIPIGMKPMLTTLIDKPFDDPNWVYEVKW
DGYRALAFCLKNGDVQLLSRNNKQFNEKFYPIFRILQGLKQDLVIDGEILIINDKGISSF
KDLQNWRSEEDGKLVYYVFDIIWYEGKDLTGLPLNVRQKILAEVLANTDDHIKISKVFNG
DGNKFYEAAVKKGLEGIIAKKSDSTYAKNTRSKDWLKIKINKYQEVVIAGYTKNSGTSKQ
FSSLLLGVYKNNELHYVGKVGTGFNDHFQKELIEKFRSLVTVKSPFFEVPNVNKGSRYKP
NPSNTKVTWLKPELVCEVSFTEVTDDGVFRHPSFRGMRIDKKAKEAVREVEIETKGFLNP
IDETQLRKLNGHPLKFTHLNKLYWPEDKVTKREMFNYYYQVADYILPHLKDRPMSLNRFP
GGINSKGFYQKDVSEIAPTWAKTFPHTTEDGEHKEYLLGNDEATLLWMASLGCIEMNPWF
SRTQTIDNPDYCVIDLDPDKNTFNQVIEAAQIVKEILDQIEIPCYAKTSGSTGMHIYIPL
GAKYSYDQSQMFARIIVNLVHREIPAFTSLERMIANRKGKMYLDFLQNRPGATIACVYSL
RPKPGATVSMPLTWDEVKPGMTMGDFTIFNAIDRIKETGDLFKGTLGKSIDLVVAINKAK
KIFG
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaaaggaatatggtaaaaaacgtgattttaataaaacagccgagcccaaagca
attaaaacaaaatccacaggaaagcttcactttgtgattcagaaacatgatgctagtcgt
ttacattacgatttccgcctggagatggaaggcgtgttaaaaagttgggcggttcccaaa
ggaccttctacagacccaaaaacaaaacgtttagcagtaatggtggaagaccatcccttt
gattataaaaactttgaaggcatcattcctaaaggcgaatatggtggaggtacagtaatt
gtttgggatgaaggaacctatgaacctattgaaaaggttaaaggtaaaaaagcacaggag
aaatatttacttaaccaattgcatgatggatcactcaaaattatcttgcatggcaagaaa
ttaaaaggagagtatgcacttgtaaaaacacaaggcatgggagaaaatggctggttgtta
attaaacataaagatgagtacgcctcgctggttgatatcactaaaaaggatacatcggtg
ctgtcttcacaaactatagagcaagtaaaaaaggcaaaggttactgaagtttcggcagag
gttaacacgctattgaaaaagggtaagaaatctaaaattccaattggaatgaagccaatg
ctgactaccttaatagacaaaccttttgacgaccctaattgggtttatgaggttaaatgg
gatggttatcgtgcattagcattctgtttaaaaaatggagatgttcagttactttccaga
aataacaaacaattcaatgaaaaattttatccaatttttaggatacttcagggcttaaaa
caggatttggtaattgacggcgaaattctaataattaatgataaaggtatatctagtttt
aaagatcttcaaaattggcgcagtgaggaagatggtaaactggtttattacgtattcgat
attatctggtatgaaggtaaagatttaacaggacttccgcttaatgtccgccaaaaaata
ctggcagaagttttagcaaataccgacgatcatatcaagataagtaaggtatttaatgga
gatggaaataaattttatgaagctgctgttaagaaggggctagagggaattattgctaaa
aaatcagacagcacctatgctaaaaatacccgttcaaaagattggttaaagattaaaatt
aacaaatatcaggaagtggttattgcaggttacaccaaaaatagtggtacatctaaacaa
tttagctcactcttgctgggggtatacaaaaataacgagttacattatgttggtaaagtt
ggtactggttttaatgatcattttcagaaagagctaatagagaaatttcgttcattggtt
accgtaaaaagtcctttttttgaagtcccaaacgtaaataagggatctcgctacaagccc
aatccttccaatactaaagttacctggcttaagccagaattagtttgcgaagtttcattt
acagaggtaacagatgatggcgtatttcgccacccttcatttcgtggcatgcgcatagat
aaaaaagctaaggaggcagttagagaagttgaaattgaaactaaagggtttcttaaccct
attgatgaaacgcagttacgaaaactgaatgggcaccctctaaaatttacccacttaaac
aagctctactggccagaagacaaggtaaccaaaagagaaatgtttaattattattaccaa
gtggccgactatattttgcctcatttaaaggataggcctatgtcgttaaaccgctttccc
ggcgggattaatagcaaaggattttatcagaaagatgtaagtgaaatagcgccaacctgg
gccaaaacatttcctcacacaacagaggatggtgaacacaaggagtatctgcttggaaat
gatgaggctacattgctttggatggcctcgcttgggtgcatagaaatgaatccatggttt
tccagaacccaaacaattgacaatccagattattgtgtgattgatctggacccagataaa
aacacatttaatcaggtaatagaggccgcacaaatagtaaaagagatactagaccagatt
gaaataccgtgctacgcaaaaacttcaggttcaacaggcatgcatatttacattccgcta
ggggcaaagtacagttatgatcagtctcaaatgtttgccaggatcatagtaaatttagtg
caccgtgagattcctgcttttaccagtttagaacgtatgattgctaatcggaaaggaaaa
atgtatctggatttcttacagaacagacctggagctactattgcgtgcgtttattccctt
agacccaaacctggggccacggtttctatgccacttacctgggatgaagttaaaccggga
atgaccatgggtgattttacaatcttcaatgcaattgatagaatcaaagaaactggtgat
ctatttaaaggaacacttggaaagagtattgatttagtagtggccattaataaggcaaaa
aagatttttggataa

DBGET integrated database retrieval system