KEGG   Pedobacter ginsengisoli: CPT03_18115Help
Entry
CPT03_18115       CDS       T05145                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
pgs  Pedobacter ginsengisoli
Pathway
pgs00220  Arginine biosynthesis
pgs01100  Metabolic pathways
pgs01110  Biosynthesis of secondary metabolites
pgs01130  Biosynthesis of antibiotics
pgs01210  2-Oxocarboxylic acid metabolism
pgs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pgs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CPT03_18115
Enzymes [BR:pgs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     CPT03_18115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ATP58241
UniProt: A0A2D1U9I2
LinkDB All DBs
Position
complement(4371223..4372290)
Genome map
AA seq 355 aa AA seqDB search
MIEQLQKDSLELLRKLIGIQSFSKEEDKTADAIEQFLQQRNIKTYRKLNNVWAYNKYFDK
SKPTLLLNSHHDTVKPNSGYTRDPYDAAIEDDKLYGLGSNDAGGCLVSLIATFLYYYDQQ
ELSYNICLATTAEEEISGNNGLECVLPDLGELEFAIVGEPTQMNLAIAERGLLVLDCTST
GKAGHAAREEGDNAIYKALKDIEWFRNYRFSKVSEVFGPLKMSVTIINAGSQHNVVPATC
TFTVDVRVTDAYTNEEVLKIIRTNVDCDVKPRSIRLKPSSIDKEHPLVQSGIALGRTTYG
SPTTSDQALLSIPSVKVGPGDSARSHMADEYVFVDEIAEGIALYIEMLKPVIKGK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatagaacaactgcaaaaagatagtttagaattgttaagaaagctaataggcattcag
tcttttagcaaagaggaagataaaacagctgatgcgattgaacagtttttgcagcaacgc
aacataaaaacatacaggaagcttaataacgtatgggcttataataagtactttgataaa
agcaaacctacattacttttaaactcacatcatgatacagtaaagccaaattcaggctat
acccgtgatccttatgacgcagcgattgaagatgataaattatacggattgggaagtaat
gatgcaggaggatgtctggtatcgcttatagcaacatttctgtattactatgatcagcag
gaattaagctataacatttgtttggctacaacggcagaagaagagatttcaggcaacaac
ggactagagtgtgtacttcctgatttaggtgaactggagtttgcaattgtaggtgagcca
acacagatgaaccttgcaattgcagagcgtggattgttggtactagattgtacatctact
ggcaaagctggtcatgcagcacgtgaagaaggggacaatgcaatttataaggcgcttaaa
gatattgagtggttcaggaattatcgcttttctaaagtttctgaagtatttgggccatta
aaaatgtcggttacaattatcaatgccgggtctcagcataatgttgtgcctgctacctgt
acttttacagtagatgtacgtgtaactgatgcctataccaatgaggaggtgttgaaaatt
atccgcaccaatgtggactgtgatgtgaagccacggtctatcagattaaagccatcatca
atagataaagaacacccgctggttcaatcgggcatcgcacttggaagaacaacttacggg
tcgcctacaacttcagatcaggctttgctgagcattccttctgtcaaggttggccctggt
gattcggcacgttctcatatggctgatgagtatgtttttgtagatgaaattgctgaaggt
atagcactttatattgagatgcttaagccggtaataaagggcaaataa

DBGET integrated database retrieval system