KEGG   Pedobacter ginsengisoli: CPT03_21100Help
Entry
CPT03_21100       CDS       T05145                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pgs  Pedobacter ginsengisoli
Pathway
pgs00564  Glycerophospholipid metabolism
pgs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CPT03_21100
Enzymes [BR:pgs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CPT03_21100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA HI0933_like Pyr_redox_2 NAD_binding_8 Pyr_redox_3 FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: ATP58784
UniProt: A0A2D1UB94
LinkDB All DBs
Position
5008747..5010309
Genome map
AA seq 520 aa AA seqDB search
MIFNRTAFIERIDKKSDWDVIIIGGGATGLGTAVDAASRGYSTLLLEQSDFAKGTSSRST
KLVHGGVRYLAQGDIALVYEALHERGLLLKNAAHLVKDQDFIIPCYSWFSKYKYLIGLKF
YDLLAGKSGFKKSSFLSVDKVLQAIPGLKRDGLIGGISYSDGQFDDARLALNLAQTTAEY
GGVTLNYMKVTGLNKEGGQVNGVSFTDLESGKLYSLKAKVVVNATGVFVDEILKMDLPSG
KQIVRPSQGAHVVLDKSFLQGNSALMIPKTSDGRVLFAVPWHGKVLVGTTDTPLDEHSLE
PKPLDEEIDFILSTAGKYLTKVPSRSDVLATFAGLRPLAAPGKDTNSTKEISRSHKLLTS
KSGLITITGGKWTTYRRMAMDVVDKAIELGKLPAASCITENVKIHGYTPGIDESPLGIYG
ADAQGIRRLMVEEPELNASVYPGYDYLKAEVVWMVRNEMARSIEDVLSRRMRLLFLDAKG
ALLLAPEVASMMADELEKDAKWVESQIEEFKNLVKQYLLS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgatatttaatagaacagcatttattgaacggattgataagaaaagtgattgggatgtt
ataattataggtggaggcgcaacgggattaggtacagctgtggatgctgcatcccgaggg
tatagcactctgcttttggaacagtctgattttgcaaaggggacttcgagcagaagtacg
aagcttgttcatggaggagtaaggtacttggctcagggtgatattgctctggtttatgag
gctttgcatgagcgtggattgttgcttaaaaacgcagcgcatttggtgaaggatcaggat
tttattataccgtgctattcgtggttttccaaatacaagtatttaatagggctaaaattt
tatgatttactggctgggaaaagtgggtttaaaaaatcgtcttttttatctgttgataag
gttttacaagcaattccaggtttaaaacgtgatggattgattggtgggattagttatagc
gatggtcaatttgatgatgcgaggttagcattaaacttagctcagactactgcagagtat
ggtggtgtaacgcttaattatatgaaggtgaccggccttaataaagaaggaggacaggtt
aatggtgtttcgtttactgatctggagagcgggaaattgtattcgttaaaagcgaaggtg
gttgtgaatgctacaggcgtatttgtggatgagattttaaagatggatttgccttctggc
aagcaaatagtgcggccaagtcaaggtgcgcatgtggtacttgataagtcgtttttacaa
ggtaatagtgccttaatgattccaaaaacgtccgatgggcgagttctgtttgctgttcca
tggcatggaaaagtacttgtgggcacaacagatactccactagatgagcacagtttggag
ccaaaaccattggatgaggagattgattttatattaagtacggcaggtaaatatttaact
aaagtaccatcgcgatctgatgtgctggcaacattcgccggtctacgcccgttagccgcg
cccggtaaagataccaatagcactaaagagatttcaagaagtcataagctgttaaccagc
aagtcaggactcattaccataaccggtggtaaatggactacttatcgcagaatggctatg
gatgtggtggacaaggctattgaacttggtaagttgcctgctgccagttgtattactgaa
aacgttaagattcatggatatactccagggatagatgaaagcccgctggggatttatggt
gcagatgcacaaggaataagaaggttgatggttgaggagcctgaattgaatgcttctgta
tacccgggctatgattatttaaaggcagaggtggtttggatggtaaggaatgagatggcc
cgctccatagaagatgtgctttctcgtagaatgcgattgttgtttcttgacgcaaaagga
gctttattgcttgctccggaggtagcgagtatgatggctgatgaattggagaaggatgct
aaatgggtagaaagccagattgaagaattcaaaaacctggtgaaacaatatttattgagc
tag

DBGET integrated database retrieval system