KEGG   Porphyromonas gingivalis TDC60: PGTDC60_0407Help
Entry
PGTDC60_0407      CDS       T01516                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
pgt00010  Glycolysis / Gluconeogenesis
pgt00260  Glycine, serine and threonine metabolism
pgt00680  Methane metabolism
pgt01100  Metabolic pathways
pgt01110  Biosynthesis of secondary metabolites
pgt01120  Microbial metabolism in diverse environments
pgt01130  Biosynthesis of antibiotics
pgt01200  Carbon metabolism
pgt01230  Biosynthesis of amino acids
Module
pgt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTDC60_0407 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    PGTDC60_0407 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGTDC60_0407 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pgt04131]
    PGTDC60_0407 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgt04147]
    PGTDC60_0407 (gpmA)
Enzymes [BR:pgt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PGTDC60_0407 (gpmA)
Membrane trafficking [BR:pgt04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PGTDC60_0407 (gpmA)
Exosome [BR:pgt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PGTDC60_0407 (gpmA)
  Exosomal proteins of melanoma cells
   PGTDC60_0407 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAK24576
LinkDB All DBs
Position
complement(436744..437490)
Genome map
AA seq 248 aa AA seqDB search
MKRIVLIRHGESLWNKENRFTGWTDVDLSEKGIEEAKKAGELMKKEGFQFTKAYTSYLKR
AVKTLNGVLDVMDLDWIPVEKTWRLNEKHYGMLQGLNKVETAEKYGDEQVLIWRRSYDVP
PTPMEKEDPRSPFMDPRYKGVCEKDLPLTEALCDTVNRILPYWNETIFPTLKEHDEVLVA
AHGNSLRGIIKVLKNISDEDIISLNLPTAVPYVFEFDDNLRLVKDYFLGDPEEIKKLMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagtattgattcgccacggcgaaagcttgtggaacaaggaaaatcgcttt
acgggatggacagatgtggatttgtccgaaaaaggtattgaagaagccaagaaagccggc
gaactcatgaagaaagaaggttttcagtttaccaaagcctatacttcctatctcaaacgt
gccgtcaagaccctgaacggtgtcctcgatgtaatggacttggattggataccggtggag
aagacctggcgtctgaacgagaagcactacggcatgctgcaaggcctcaacaaggtcgag
actgccgagaagtacggggacgagcaggtactcatctggcgtcgcagctacgacgttccc
cccacgcctatggagaaagaggatccgcgctctccgttcatggatccgcgctacaaaggt
gtgtgcgagaaagacctgccactgacagaagctctctgcgacacggtaaatcgtatcctc
ccctattggaacgagaccatattccctacactcaaggagcatgacgaggtattggtagcg
gctcacggcaacagtctgcgtggtatcatcaaggtgctgaaaaacatttcggacgaagac
atcatcagcctgaacctcccgacagccgtgccttacgtttttgaatttgacgacaatctc
cgtctggtgaaggactatttcctcggcgatcccgaagagatcaaaaagctgatggaggca
gtagccaatcagggcaagaagaaataa

DBGET integrated database retrieval system