KEGG   Porphyromonas gingivalis TDC60: PGTDC60_0817Help
Entry
PGTDC60_0817      CDS       T01516                                 

Definition
(GenBank) alkaline phosphatase, putative
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
pgt00730  Thiamine metabolism
pgt00790  Folate biosynthesis
pgt01100  Metabolic pathways
pgt02020  Two-component system
Module
pgt_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pgt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PGTDC60_0817
   00790 Folate biosynthesis
    PGTDC60_0817
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PGTDC60_0817
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgt04147]
    PGTDC60_0817
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pgt00537]
    PGTDC60_0817
Enzymes [BR:pgt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PGTDC60_0817
Exosome [BR:pgt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGTDC60_0817
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pgt00537]
 Enzymes
  PGTDC60_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: BAK24979
LinkDB All DBs
Position
851229..852920
Genome map
AA seq 563 aa AA seqDB search
MKRIKQTLSTILLFIIVLSPALYAGQPREVKPVRNVILMIPDGTSLSAVSLARWYQRYLN
PDRRHLAIDPYICGTVLTYSSDAPIGDSAPTTSCYMTGMPSNTGFVSTYPVSSGDADLIP
VDKARAYSPLATFLEAAKIMKGKKTGLVVTCHFPHATPADCSAHSYSRKKYDWIAAQMVH
QNLDVVLGGGTHYLHPELQSVLNSRGYGLFLDDLNGMRTYAGDKMWALFGKREMPYDLDR
DTTQIPSLEEMTRLAIEKLNRSEEGFFLMVEGSKVDWAAHANDPVGIATEYLAFDRACAV
AFDFARRDGQTAVIIVPDHGNSGVSIGKQSVKDYDKRSAKDLFDQLCRFRLTADGLAGRL
ADTPADKVQGLVSNICGFELDAKELEALYNCPDYNHSPIPKEQRRQTEESLYSGSLSTFI
ASLYTKHTSIGFTTHGHTAEEVLLAAYHPQDTRPMGMVINYELNDYLCRLFELGSQLPVL
TDKIFAPHTEVFQGMSYSIKDGKKEGELPVLEVKKGSYRLLASPFSNTVIFNKKAIDLSS
VVVYVDKTKTFYLPRELRSLFGE
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatcaaacaaactcttagtacgattcttctttttattatcgtactctctccg
gctctatatgccggtcagccacgggaggtcaagccagttcggaacgtgattctgatgatt
cccgatggtacctctctttcggctgtttctctggctcgctggtatcaacgatacctgaat
cccgaccgccggcatttggctatagatccatatatatgtggtactgttctgacctattcg
tccgatgccccgattggagactctgctcctactacctcgtgctatatgacaggtatgcca
tccaatacgggttttgtgtcgacttatcctgtcagttcgggtgatgcagatctgattccg
gtggataaggctcgtgcttattctcctttggctacttttctggaggcggctaaaataatg
aagggaaagaaaacgggtttggtcgtgacttgtcacttccctcatgccacaccggccgat
tgctcggcacactcttattctcgtaagaaatacgattggattgcagcgcagatggtacac
caaaatctggatgttgtactcggaggcggaacgcactacctccatccggaactgcaatcc
gtactcaatagccgtggctatgggctctttctggatgacctgaatggaatgcgcacttat
gcgggagataagatgtgggctttgttcggcaaacgagaaatgccctatgatttagatcgt
gatactacacaaatcccttcactggaggagatgactcgcttggctatagagaagctgaat
cgttctgaggagggctttttccttatggtcgagggtagtaaagtggattgggctgcacat
gccaacgatcctgtggggattgctaccgaatatcttgctttcgatcgtgcttgtgccgtg
gcattcgactttgcccgtcgtgacggacaaacggctgtcatcatcgtgccggatcatggc
aatagcggtgtaagcataggcaaacaaagtgtgaaagactatgataagcgttctgcaaaa
gaccttttcgatcaactctgtcgcttccgcctgacagcagacggacttgcagggcgtttg
gctgatactcccgccgacaaggtccagggtttggtaagcaatatctgcggattcgaattg
gacgccaaagagttggaagctctttataattgtccggattataatcatagtcctatcccc
aaagagcagcgcaggcagacggaagaatccctctacagcggttcgctcagtaccttcatc
gcatcgctttatacgaagcacacttcgatcggttttacgacgcacggacatactgccgaa
gaagtattgttggcggcctatcaccctcaagatacacgcccgatgggaatggtcataaac
tatgaactgaatgactatctctgccgtctcttcgaattaggaagccaattgcccgtcctt
accgacaagatatttgctccccatacggaagtattccaaggcatgagctacagtatcaaa
gacggaaaaaaggaaggagaactgcctgttcttgaagtgaaaaaaggtagctatcgctta
ctggcgagtcctttctccaatacggttatcttcaataagaaagcgattgatctgtcttcc
gtagtagtctatgtagataagactaagactttctatttgcctcgtgaactgcgttcttta
ttcggagaataa

DBGET integrated database retrieval system