KEGG   Porphyromonas gingivalis TDC60: PGTDC60_1850Help
Entry
PGTDC60_1850      CDS       T01516                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
pgt00473  D-Alanine metabolism
pgt00550  Peptidoglycan biosynthesis
pgt01100  Metabolic pathways
pgt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pgt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PGTDC60_1850 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PGTDC60_1850 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PGTDC60_1850 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pgt01011]
    PGTDC60_1850 (ddl)
Enzymes [BR:pgt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PGTDC60_1850 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:pgt01011]
 Precursor biosynthesis
  Amino acid ligase
   PGTDC60_1850 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp GARS_A CPSase_L_D2 ATP-grasp_4 TTL ATPgrasp_ST ATPgrasp_YheCD PolyA_pol_RNAbd
Motif
Other DBs
NCBI-ProteinID: BAK25999
LinkDB All DBs
Position
complement(1919507..1920502)
Genome map
AA seq 331 aa AA seqDB search
MMKKPIVAVIAGGYSGEHSVSLKSAAGILSWLGSEPFSTFLVLIERDRWSVRVSEQREVP
LDKNDFSFDLDGERIRFDYAYITIHGTPGENGLLQGYLDMIGIPYNTGDTLVESLTFNKY
VCNRFLSGFGIRIADSMRLTGRDTQPDVADLIARMGLPLFVKPNVGGSSIATTKVVEAAQ
LLPAIEQAFSEGEEVMIERLICGTEVTCGAFLRKKEVVALPVTEVVAHNEFFDFDAKYNG
AVEEITPARISDEATRLIQTMTARIYELLNARGIIRVDYIIEADGIPTLLEVNTTPGMTP
TSFIPQQVRAAGMDMKEVLCTIIRDGLNETQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaaccaattgtggctgtcattgcaggcggttattcgggcgaacattcggtt
tcgctcaaaagtgctgccggcattctgtcctggctgggaagcgagcctttctccaccttt
cttgttctgatcgaacgtgatcgctggtcggtaagagtatcggagcagagagaggttcca
ctggataagaacgatttcagctttgatctcgatggcgaacgaatacggtttgactatgct
tatatcaccatacatggaactccgggagagaacggtctgcttcaggggtatctcgacatg
atcggcatcccatacaatacgggtgatacgctcgtcgaatccctgactttcaacaaatat
gtgtgcaatcgttttctctccggcttcggtatccgcattgccgattctatgcgactgacc
gggcgagatactcagcccgatgtggcggatctgatagcacgtatggggcttcctcttttc
gtgaaacccaatgtgggaggttccagcatcgcgactaccaaggtggtggaagctgcacag
ctccttccggcaatagaacaagccttctcggaaggcgaagaggtaatgatagagcgtctg
atatgtggtaccgaggttacctgcggggcattcctcagaaaaaaagaagtggtcgcattg
cctgttacagaagttgtcgcacataatgagtttttcgacttcgatgccaaatacaacgga
gctgtagaggaaatcacaccggcgagaatcagcgatgaagccactcgattgatacagacc
atgactgcgcgcatatacgagcttctcaacgctcggggcatcatacgtgtggactatatc
atcgaagcggatggtattcccacgctgctggaagtgaacacgacaccgggcatgacccct
acgagctttatcccccagcaggttcgagcagccggaatggatatgaaagaggtgctttgc
actatcattcgggatggactgaatgagacccaatag

DBGET integrated database retrieval system