KEGG   Meyerozyma guilliermondii: PGUG_00321Help
Entry
PGUG_00321        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    PGUG_00321
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pgu03036]
    PGUG_00321
Enzymes [BR:pgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PGUG_00321
Chromosome and associated proteins [BR:pgu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     PGUG_00321
   HMT complexes
    COMPASS/SET1 complex
     PGUG_00321
    COMPASS/SET1 complex (yeast)
     PGUG_00321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET_assoc SET
Motif
Other DBs
NCBI-GeneID: 5128987
NCBI-ProteinID: XP_001486944
UniProt: A5DAL6
LinkDB All DBs
AA seq 1055 aa AA seqDB search
MSYRFKGPDRGDRGDRNDRGGGYHTNYDDKYRREVAPKLSNLYDSFRPSGPRKHNTNHYD
RDAYYRPMEHRNPSKPAQTPSTNPKPEFKPDHEQENGRHSHHGNVQNHTRSPLQPPTPNS
VTSAPEEVTGTDPRTGVNPHDLKVPTLQLHRDHLQLEFSSPSDPPKNYKVLYDPENDSHR
NKSTNKSKSKVFRFNGSSVSDPQSYSDAIIHSSDITDPRKKILSTYFSKPNKNSKKFPFK
QLPQPRFVFDKNSVGPPPQTELVVWDIPSTTSEVYVTNFFRSHGNATEINFLQDPMYAVP
LGVMLFRFQGSPDKSMLLAKNLLNFVHLEKPKINGVVLKIELNDHEGKLLRSKVEIAQNR
IRQSKQKLEMEEQKRREMEEEKKRKEIVAQREEARQKESQNNTFQKYDYKPNTTIMSVKY
RNKVIPGTFLPREVRHIIKDNPYLFIHDKHVSTRTVSAQDIKRVLNKYNWSRVLHEKVGF
FIIFNSLEECKRCFWKEDGRRFYEFRMFMEMAVPEGFEDKSTTSATKGDAVEEATNMLIQ
EFQAYLKKDIRERVIAPQVLELLNPERFPVLKAQLDEERTKQAQAAAARAETIASKIQET
RNKEGAYALMNKKAAQLPSFKRKEGIKMQAKKRVIPMQHVLNYENDSDDSEDDSSRSATP
APALKRERSLPATSYDEEAPSKKKKKTLLKTMLLYDSSEGEVSDSPEDQVMEDAEEAADQ
VDDFADVDVKFRPTLHSSVPVYPEDEFVDEFDVNYIQSSIKDEEDLNIAKSILSELKPST
IANVDYWAWKQKETRKPEEIAESVHLIEPLAPKFESASGSFRSEGYRKIPDTDKIEYLPH
RRKIYKPVKTVQHEDDETSANNGNGTNNSTAVHSSRVNRANNRRLVADISAQKQMLGSET
DILDLNALTKRKKPVTFARSAIHNWGLYALESIAAKEMIIEYVGESIRQQVAEHREKSYL
KTGIGSSYLFRIDENSVIDATKKGGIARFINHCCNPSCTAKIIKVEGKKRIVIYALRDIE
ANEELTYDYKFERETNDDERIRCLCGAPGCKGYLN
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacagatttaaaggtcccgatcgtggagatcgtggagaccgtaatgatcgtggc
gggggctaccacaccaactacgatgacaagtatcggcgtgaagttgctccaaaactttca
aatctgtacgatagctttcgaccatcaggtccacgaaaacacaacacaaatcattatgat
agagacgcttactaccgacccatggagcatcgaaatccatccaagccagcacagacaccg
tccacaaacccaaaaccagagtttaagccagatcacgaacaagaaaatggccgtcactct
caccatggcaatgttcaaaatcacacacgatcgcctctccaacctccaacgcccaatagt
gtgacctctgcgcccgaggaagtgacgggaacagacccccgaaccggagtgaacccccat
gaccttaaagttccaactttacagctccatcgtgatcatctccagctcgaattttcatca
ccatccgatcctccaaaaaactacaaggttctctacgatccagagaacgattcccacaga
aacaagtccaccaacaaatcaaaaagcaaagtatttcgctttaatggctcgtctgtaagt
gacccacaatcatacagtgatgccataatccacagctccgatatcaccgatccacgaaaa
aagatcctttccacctacttttccaaacccaacaaaaactccaagaaatttccattcaag
caactcccacagccgcgatttgtgtttgacaagaactcggtgggtcctcccccgcaaact
gagcttgtggtgtgggacattccatccaccaccagcgaggtctacgtgacaaacttcttt
agatctcacgggaatgcgaccgaaattaacttcctccaggacccaatgtatgcggtacct
ttgggcgttatgctgtttcgtttccaaggctctcctgacaaatcaatgcttttggccaag
aatctcctcaatttcgtccaccttgaaaaacccaaaatcaacggcgtggtgctcaagata
gagcttaatgaccatgagggaaagttgctccgtagcaaggtggaaattgcccaaaatcga
attcggcaatcgaaacagaaattggagatggaagaacagaaaagaagagagatggaagag
gaaaagaaacgtaaagagatcgttgctcagagggaggaagcacgccagaaagaatcacaa
aacaataccttccaaaaatacgactataaaccaaacaccaccatcatgtctgtcaagtat
cgcaacaaggtcattccaggaacatttcttccacgagaagttcgtcatatcatcaaagac
aacccctatctattcatacacgacaaacacgtttccacacggaccgtatctgcccaggat
atcaagcgtgtgctcaacaagtacaactggtctcgagtcctacacgagaaggtaggattt
ttcataattttcaattctttggaggagtgcaaacgatgtttctggaaggaagatgggcgt
aggttctatgaatttcgtatgttcatggagatggctgtgcctgaaggttttgaagacaag
tccacaacttctgccaccaaaggtgacgccgtcgaagaagcaacgaatatgctcatacaa
gagttccaagcataccttaaaaaagatatacgtgagcgagtaattgcaccccaagtattg
gaattgttgaacccggaaagatttcctgttctcaaggcacaattggacgaagagcgaacc
aagcaggcacaagctgctgccgctagggccgaaacgattgcaagcaaaatccaagaaact
cgaaataaagaaggtgcttatgctctaatgaataaaaaagcggcacagttacccagtttc
aaaagaaaagaaggcataaaaatgcaagcgaagaagagagttattcctatgcagcatgtc
ctcaactatgaaaatgactcggacgattcagaagacgattcaagtcgttctgctactcct
gctcccgcgttgaagcgtgaacgcagcctgccagcaaccagctatgacgaagaagcaccc
tcaaagaagaaaaagaaaacactgctcaagacaatgttgctttacgactcatcagaagga
gaagtttccgacagtcctgaagatcaagtcatggaagatgcagaggaggcggctgaccaa
gtggacgattttgccgatgtggatgtcaagttcagacctacattacactcttcagttccg
gtgtaccctgaggatgaatttgttgacgagttcgacgtcaattatatccaatcttccatc
aaagacgaggaagatttgaacattgcaaagagcattctttctgagttgaagccttccaca
atagcaaatgtggactactgggcgtggaagcaaaaagagactcgaaagccagaggaaatt
gccgaaagtgtacatctaattgaacctcttgcacccaaatttgagtcggcaagtggctct
ttccgcagtgaaggatacagaaaaatacccgatactgacaagatcgaatacttgcctcat
cggcgcaaaatttacaagcctgtcaagaccgtccaacacgaagatgacgagacttctgcg
aacaatggaaacggtacgaataacagcactgcggtgcatagctctcgtgtgaaccgtgcc
aacaacagaagattggtggctgatataagtgcccagaagcaaatgcttggaagcgaaact
gacattttggatctcaatgcgttgacgaaaagaaagaaaccggtgacttttgcgaggtcc
gcgatccataactggggcttgtacgccttggaatcaattgctgcgaaggagatgattata
gagtacgttggggagagtattcgacagcaagtagccgagcaccgtgagaagagttacttg
aagacaggcattgggtcgtcgtatcttttccgaattgacgagaattcagtgatcgatgca
accaaaaaaggcggaatagctcgtttcatcaaccattgctgtaaccctagttgtactgcc
aagatcatcaaagtggaaggaaagaagagaattgtcatttacgctttgcgagacatcgaa
gctaacgaagaactcacctacgactacaaattcgaaagagagacgaacgacgacgaacgg
atccgttgtttgtgtggtgcccctggctgtaagggctatttgaactag

DBGET integrated database retrieval system