KEGG   Meyerozyma guilliermondii: PGUG_00446Help
Entry
PGUG_00446        CDS       T01150                                 

Definition
(RefSeq) cAMP-dependent protein kinase type 2
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu04113  Meiosis - yeast
pgu04138  Autophagy - yeast
pgu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    PGUG_00446
  09143 Cell growth and death
   04113 Meiosis - yeast
    PGUG_00446
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    PGUG_00446
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pgu01001]
    PGUG_00446
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pgu03019]
    PGUG_00446
   03036 Chromosome and associated proteins [BR:pgu03036]
    PGUG_00446
Enzymes [BR:pgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PGUG_00446
Protein kinases [BR:pgu01001]
 Serine/threonine kinases: AGC group
  PKA family
   PGUG_00446
Messenger RNA biogenesis [BR:pgu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PGUG_00446
Chromosome and associated proteins [BR:pgu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    PGUG_00446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase APH YrbL-PhoP_reg Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 5129381
NCBI-ProteinID: XP_001487069
UniProt: A5DAZ1
LinkDB All DBs
AA seq 406 aa AA seqDB search
MSPNLLQKLHLTKANQNVTVNSLHNIETMENISQQHQPIVTPQDQMLAQSQAQAQAQAQA
QAEHELQQQRAQEAIERSLLPQRSTVSKGKYSLTDFHIMRTLGTGSFGRVHLVRSVHNGR
YYAIKVLKKHQVVRMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDSKNLFMVMDYIEGGE
LFSLLRKSQRFPNPVAKFYAAEVILALEYLHTHDIIYRDLKPENILLDRNGHVKITDFGF
AKEVSTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIFEMLAGYTPFYDTTPMKTY
EKILSGKIHFPSYFHPDVIDLLTKLITADLTRRLGNLRNGPADIRNHPWFQEVVWEKLLA
KDIETPYEPPITAGVGDSSLFDHYPEEQLDYGSVGEDPYALYFTEF
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccaatctacttcaaaaacttcacttgaccaaggccaaccaaaacgtgacagtt
aactctctccacaacattgaaaccatggagaacatctcgcaacagcaccagccaattgtg
acaccccaagaccagatgttggctcaatcgcaggcccaggcccaggcacaagcccaggct
caggctgaacacgagctacaacagcagagagctcaagaagctatcgagaggtcgcttctt
cctcaaagatcgaccgtaagtaagggcaagtattcattgacagatttccacataatgaga
acattgggaacaggatcgtttggacgagtccatttggtccggtctgtgcacaatggcaga
tattacgctataaaagtgttgaaaaagcatcaagtggttagaatgaagcaggtggaacac
acaaacgatgaaagaagaatgcttaaattggttgaacatccttttttgattcggatgtgg
ggaacgttccaggactctaaaaacttattcatggtgatggactatattgaaggtggtgag
ctctttagcttgttacggaaatctcaacggttccccaacccagtagccaagttttacgct
gctgaagtgatattggcattggaatacttgcacacccacgacatcatttaccgtgatttg
aaacctgaaaacatattattggacagaaatggacatgtcaaaatcaccgattttgggttt
gccaaagaagtcagcactgttacctggactttgtgtggaacccctgactatatcgcccca
gaggttatcactaccaagccctacaacaagtcggtggactggtggtcgttgggagtgttg
atctttgaaatgttggctggttacactccattctacgacaccacccccatgaaaacttat
gaaaagattttgtccggtaagattcatttccctagctactttcatcctgatgttattgac
ttgttgaccaaactcatcactgctgatttgacccgaaggctaggaaacttgcgtaatgga
cccgccgatatcagaaaccatccatggttccaggaagttgtgtgggagaaattgctcgcc
aaagacatcgaaacgccgtatgagcctcctattactgccggtgtgggagactcatcgtta
ttcgaccactacccagaagaacagttggactacggctcggtaggcgaagatccttacgct
ctgtactttaccgagttctaa

DBGET integrated database retrieval system