KEGG   Meyerozyma guilliermondii: PGUG_00799Help
Entry
PGUG_00799        CDS       T01150                                 

Definition
(RefSeq) similar to UDP-glucose-starch glucosyltransferase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00500  Starch and sucrose metabolism
pgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PGUG_00799
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pgu01003]
    PGUG_00799
Enzymes [BR:pgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PGUG_00799
Glycosyltransferases [BR:pgu01003]
 Polysaccharide
  Storage polysaccharide
   PGUG_00799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_4 Glyco_transf_5
Motif
Other DBs
NCBI-GeneID: 5129097
NCBI-ProteinID: XP_001487422
UniProt: A5DBZ4
LinkDB All DBs
AA seq 702 aa AA seqDB search
MTRDINSHLLFEVATEVAHKVGGIYSVLKSKAPITVAEYRERYTLIGPLNYSSAQIEVEE
LPVKDPKIKAALDSMSERGIKWLYGRWLIEGAPRVLLFDIHSAGHHLNEWKSDLWNLAGI
PTPDHDQESNDAILLGYLVAWFLGELVYHDQERAVICHCHEWLAGVALPLCRKRRIDVTT
IFTTHATLLGRYLCAGSTDFYNNLSNFDVDAEAGKRGIYHRYCIERAATHSADVFTTVSH
ITAYESEHLLKRKPDGVLPNGLNVVKFQAVHEFQNLHALKKAKINEFVKGHFYGNYDFDL
DNTLYFFIAGRYEFRNKGCDFFIEALARLNHRLKESGSKTTVVAFIIMPGKSHSYTVETL
KGQAVIKQLESTIEEVQKKVGERLFEHCARFPNDHSIATTQGKEVPSIDELIKPADRVLL
KRRIFALKRDGLPPIVTHNMADDASDPVLNHIRRVQLFNKPEDRVKIIFHPEFLNANNPI
LSLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEDLIENTSDY
GIYIVDRRMKSVDESINQLADCMYDFSMKTRRQRINQRNRTERLSDLLDWKRMGLEYIKA
RQLSLKRAYPDKFKNGANPFNNTENLKLTRPLSVPGSPRGKVGIMTPGDLGSLQEAAQHF
DSEDYIGFKLGGHQQDDDEDDNEHYPLTLRGNSVPPTDVEDA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgaccagagatatcaacagccatcttctatttgaagtggccaccgaggtcgctcacaag
gtgggaggcatttactcggtgctcaagtcgaaagctcccattacagtggcagaatatcga
gaaagatacacattaattggaccattgaattacagttcggcgcaaattgaagtcgaagaa
ttgccggtgaaagaccccaaaattaaggcggctctcgactccatgagtgagagaggcatc
aagtggctctatggtcggtggttgatcgaaggagctccccgagtgcttcttttcgatatc
cattcggcgggccatcatctcaacgaatggaaatctgatttgtggaaccttgctggaatt
cccacccctgaccatgaccaggagagcaacgatgccattttgttgggttatttggttgcg
tggtttttgggagaattggtatatcacgaccaagaacgtgcggttatctgccattgtcac
gaatggttagcaggtgtggccttgcccttgtgcagaaaaagaagaattgatgtcactacc
atcttcaccacccatgctactctcttgggccgttacttgtgtgctggttcgacagatttt
tacaacaatttgtccaactttgacgttgacgccgaagctggaaaaagaggcatttaccat
cgttactgcattgaaagagcagcaacacactcagctgatgtgttcacgacggtgtcgcac
attaccgcctatgagtctgagcatttgttgaaaagaaagccagatggtgttcttcccaat
ggtttgaatgtggtcaagtttcaagcggtgcatgagttccagaacttgcatgccctcaaa
aaggccaaaatcaacgagtttgtcaagggccatttctacggcaattacgactttgacttg
gacaataccttgtattttttcattgctggaagatacgagttcagaaacaaaggttgcgat
tttttcatcgaggcattggccagattgaaccatcgtttgaaagaatctggctcgaagacc
acggtagttgccttcattatcatgcctggaaagtcacattcgtacaccgtggagacctta
aaaggtcaggctgtaatcaagcaattggaaagcacaattgaggaagttcaaaagaaagtt
ggcgagagattgtttgagcattgtgccagattccccaacgaccactctattgctactaca
caaggaaaggaagtgccatcaattgacgaattgatcaaacctgctgatcgggttttgttg
aaaagacgtattttcgccttgaagagagatggtcttccaccaattgtcacccacaacatg
gccgacgacgcttcagatcctgtgttgaaccacattagaagagtacaattattcaacaag
cccgaagacagagtgaagataatctttcatccagaattcttgaacgcaaacaaccctatc
ttgtctttggactacgacgaattcgtcagaggctgtcacttgggtgtgttcccatcatac
tatgaaccatggggttatactccagccgaatgtactgtcatgggagttccttccatcacc
accaacttgtcaggattcgggtgttacatggaagatttgatcgaaaacacctccgactac
ggaatctacattgtcgacagaagaatgaagtcggtggatgaatcgatcaaccaattggca
gattgtatgtacgacttctccatgaagacaagacggcagagaatcaaccagcggaaccgt
accgagcggttgtctgacttgttggactggaagcgtatgggcttggaatatatcaaggca
agacaattgtcgttgaagagagcatatcccgacaagttcaagaatggagccaacccattc
aacaacaccgaaaacctcaagctcaccagaccattgtctgttccaggctcgccaagaggc
aaggtgggaatcatgacccctggagatttggggtctttgcaagaggcagcacagcacttt
gattccgaagactacattgggttcaaattgggcggccaccagcaagatgatgatgaagat
gataatgagcactatccgttgacattgagaggaaattccgtacctccaactgacgtcgaa
gatgcctaa

DBGET integrated database retrieval system