KEGG   Meyerozyma guilliermondii: PGUG_01643Help
Entry
PGUG_01643        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00052  Galactose metabolism
pgu00500  Starch and sucrose metabolism
pgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PGUG_01643
   00500 Starch and sucrose metabolism
    PGUG_01643
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PGUG_01643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C Glyco_hydro_42C
Motif
Other DBs
NCBI-GeneID: 5127792
NCBI-ProteinID: XP_001485972
UniProt: A5DEE2
LinkDB All DBs
AA seq 567 aa AA seqDB search
MTINAEPWWKTATVYQIWPASYKDSNGDGFGDLQGIISELDYVKSLGVDVIWLSPMYDSP
QDDMGYDISNYNAIYPKYGTMKDMDQLIDQVRSRGMKLVLDLVVNHTSSEHEWFKESRSS
KDNPKRNWYIWKPPKYDEQGNRQPPNNWKSCFSGSAWEWDEHTQEYYLRLFAATQPDLNW
ECEETREAIYEYAMKFWYEKGVDGFRIDVAALYSKVQTFEDAPIVDHTQKWQPFGSLCLN
GPRIHEFHKEMYKKVTSHYDVMTVGEVGHCSREEALKYVSASANEMNSIFLFDLVEVGVK
GLGRYDFAGWNLDDMRKAVKNMSGFAEGTDAWATAFSENHDQPRSVSRFGTDKNPKGHNK
SAKLLAQMLSSLSGTLYIYQGQEIGMTNLPRSWPISEYKDIETLNYYEDFKQRIGDDKEK
LEKLMDVVQIMARDHARSPVQWDNSKHGGFTTGEPWMRVNDNYPEINVASQVNDPSSVFS
FWQKCLKVRKSHSETLIFGDLKIVDNGHEKLFIFTKENGNKKALVALNFSEETVPYVAEE
GYNLVLTNFDENSDSHLAPYEARTYIK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaacgctgaaccttggtggaaaactgccacagtataccagatctggcccgct
tcgtacaaggattccaatggagacggttttggagatcttcaaggtattatttcagaactt
gactatgttaagtctctcggagtggatgtgatttggctttctccaatgtacgattcaccc
caagatgatatgggatacgatatttccaactacaatgccatttaccccaagtatggtact
atgaaggacatggatcaattaattgaccaggtccgtagtcggggcatgaagctcgttctt
gaccttgtggtgaaccataccagtagtgagcatgaatggttcaaagaatcaagatcttcc
aaggacaatcccaagagaaactggtacatctggaagcctcccaagtatgacgagcaagga
aatagacagcctccaaataactggaaatcttgtttctccggttccgcatgggaatgggat
gaacatacccaagaatattatcttcggttatttgcagccactcagccagacctcaattgg
gagtgtgaggagaccagggaggccatttatgagtatgctatgaagttttggtacgaaaaa
ggtgtggatgggttcagaatcgatgtcgcagctttatactccaaagttcaaacttttgaa
gatgcaccaattgtggaccacacgcaaaagtggcagcctttcggaagcttgtgtctgaat
ggtcctcgtatccacgagttccacaaggaaatgtataagaaagtgaccagccattacgac
gttatgacggttggagaggtgggccattgcagccgtgaagaagcactcaaatatgtttcc
gcttcagccaacgaaatgaactcgatttttctctttgatttggtcgaagtgggtgtcaag
ggacttggtaggtacgattttgctgggtggaatttggacgacatgagaaaagccgtgaag
aatatgagtggtttcgcagaaggaaccgatgcttgggccactgctttctctgaaaaccac
gaccaacctcgttcagtttctcggtttggtactgacaagaaccccaagggccacaataag
tccgctaaactcttggcacaaatgttaagctcgctttctggaaccttgtacatctaccaa
ggtcaggaaattggaatgacaaatcttccacggtcatggcccatttctgagtacaaggat
atcgagacgttgaactactacgaggactttaagcagcgtattggcgacgataaagaaaaa
ttggaaaaattaatggacgttgttcaaatcatggccagagaccatgccaggtctccagtg
caatgggacaattccaaacacggaggattcaccacaggcgagccatggatgcgtgtcaac
gataactatcccgaaatcaacgttgcttcgcaagttaacgatccttcgtcggttttcagt
ttctggcaaaaatgtttgaaagtgagaaaatcgcactctgaaactctcatttttggagac
ttgaaaattgttgataacggccacgaaaaactctttattttcaccaaggaaaacggcaac
aaaaaggctcttgttgcgttgaacttctccgaagaaaccgttccatacgttgcggaagaa
ggttacaacttggtgctcaccaactttgacgaaaactccgactctcatttggcgccctac
gaagctagaacgtacatcaaatag

DBGET integrated database retrieval system