KEGG   Meyerozyma guilliermondii: PGUG_01769Help
Entry
PGUG_01769        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
Organism
pgu  Meyerozyma guilliermondii
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 5127899
NCBI-ProteinID: XP_001486098
UniProt: A5DER8
LinkDB All DBs
AA seq 205 aa AA seqDB search
MTFFLTTQDTYFYDAPWNKSETGVAIMNVATLIGAIIGCIMSGILSDYHVLWLARRNNGR
MEPEFRLYLLFITLVISPLGLIMFGVGADKTWPWQAVYVGLGFIGVGWGSIGDTAMSYLM
DAYPEIVIQGMVGVSIINNTLACVFTFVCSYWLDGAGTANTYIVLAVIDFVSIAFIVPTL
IWGKSWRRNTKKLYVELVELTQGMG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttttcttgacaactcaagacacctacttttatgacgctccgtggaacaagagt
gagacaggtgttgcaatcatgaacgtagccaccttaatcggggctataataggatgcata
atgtcaggtatcttgtccgactatcacgttttgtggctagcaaggagaaacaacggaaga
atggagcctgagttcagattataccttttatttataaccctcgtcatttctccacttgga
ttaattatgtttggtgttggagcagacaagacttggccttggcaagcggtctacgttggc
cttggattcatcggtgttggttggggttcaattggtgacactgctatgtcatatctcatg
gacgcttatcctgaaattgtcatccaaggcatggttggggtttccatcattaacaacaca
ctcgcatgtgtgttcacgttcgtttgttcatattggttagatggtgctggaactgcaaac
acatacattgttctagctgtgattgatttcgtgtcgattgcgtttattgttcctacgttg
atctggggaaagtcctggagaagaaatactaagaaactctacgtcgagttggtcgaactc
acccaaggtatgggttaa

DBGET integrated database retrieval system