KEGG   Meyerozyma guilliermondii: PGUG_01906Help
Entry
PGUG_01906        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00500  Starch and sucrose metabolism
pgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PGUG_01906
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PGUG_01906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 5128039
NCBI-ProteinID: XP_001486235
UniProt: A5DF55
LinkDB All DBs
AA seq 403 aa AA seqDB search
MLMEHLYDTNLGDSKTKRLVELYISNCHTLQRLDNLSGKFDDEKRSGLGEPKFYLNSTPF
NGAWGRPQSDGPALRLSTIIQYLNLLLAHKAKFENPDLESPYYVYHEIVKPDLEFVVANW
EMQTFDLWEEIHGVHLYTSMAHLRSLVDGIDIARAFGDFEFVQNLTSTFESVKKFILSEA
GFVGENHLLETPSLVMSGKRGGLDSAIILAALHSHNLEAGNHTSIPFDIDDSKVLQTLHA
FVDQMKQLYHLNRNLSGEGIGAALGRYPEDIYNGVGTSEGNPWFLCTASAAEAVYKLVYK
LNHNRQDIIIDECNREFFKQFFPQRLGNKISYGSDDFKLITSRMFSYSDSFLQIIQAHVD
DQGHISEQFNRYNGLMEGARDLTWSYGAVWNAIRWRKKAIGYI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgctcatggaacatttgtatgacacgaacttgggagattccaaaacgaagcgtttagtt
gagctttatatttctaactgtcatactcttcaacgacttgacaatttgagcggaaaattt
gacgacgagaaacgctctggtttgggcgagccaaagttttacttgaactctacaccgttt
aacggggcatggggtcgtccacagagcgacggtccggcgttgagactgtctactattatc
cagtacctcaatttgctcttggcacataaggcaaaatttgagaatcccgatcttgagtct
ccatactacgtttaccatgaaatagtcaaaccggatcttgagtttgtcgttgccaactgg
gagatgcagacatttgatttgtgggaggagatacatggggttcacttatacacttccatg
gcacatcttcggtcattagtcgatggcatcgacatagcacgagcgtttggcgactttgag
tttgttcaaaatttgacgtcaactttcgaaagcgttaagaaatttatattgtctgaggct
gggtttgtgggtgaaaatcaccttctagaaaccccaagtttggtgatgtcgggtaaaaga
ggaggccttgattcagcaatcattctcgcagctctccactcccataatttggaagctgga
aaccatactagtataccctttgacatcgacgatagcaaggttctacaaacattacatgca
tttgtcgaccaaatgaagcaactttatcacttgaacagaaacttgagtggggagggtatt
ggtgccgctctcggacgttatccggaagacatttataatggagtcggaacttctgagggc
aacccgtggtttctctgcactgcatctgcagccgaagccgtttacaaattggtgtacaaa
ttgaatcacaatcgtcaagacattatcattgatgaatgtaatcgagaattcttcaagcaa
ttttttccccaacgtctaggaaacaagatttcgtatggatctgacgatttcaaattgatc
acctccagaatgttcagttactctgattcattcttgcaaattattcaggcccatgtggac
gaccaaggacacatatctgaacagttcaatcgatataacggactcatggaaggcgctcga
gacttgacgtggagctacggtgctgtgtggaatgctatcagatggagaaagaaagccata
ggctatatttga

DBGET integrated database retrieval system