KEGG   Meyerozyma guilliermondii: PGUG_02042Help
Entry
PGUG_02042        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00250  Alanine, aspartate and glutamate metabolism
pgu00410  beta-Alanine metabolism
pgu00430  Taurine and hypotaurine metabolism
pgu00650  Butanoate metabolism
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
Module
pgu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PGUG_02042
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PGUG_02042
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PGUG_02042
   00430 Taurine and hypotaurine metabolism
    PGUG_02042
Enzymes [BR:pgu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PGUG_02042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 5127709
NCBI-ProteinID: XP_001486371
UniProt: A5DFJ1
LinkDB All DBs
AA seq 509 aa AA seqDB search
MTNETIECDLESYRTEELDSLLKQLQPRILDYISKADPSRDEYQEDSLGRYHSPQFLKKE
FTDDAKLQSGIRKHPQEVFEVIDKVLEYSVNTWNPGFLDKLYASNNPIGVVSDIILSVLN
TNSHVYTVSPVLSVLENYIGKKYAGLFFKDHQETCGGLTFSGGSWSNITSLQMARAMKYP
DTKIEGNNGRRFAIYSSKHCHYSVEKAAILLGLGSGSLFKVDILEDGTMDVASLKQAIKK
SKLEGYIPLYVNATAGTTVFGSYDPFGEIAAVAKEHNLWFHIDGSWGGNVIFSPTHSAKL
KGSELADSITVNPHKMLGVPTTCSFLLVPHVVDFQNAMSLSAPYLFHGRENELEENFDLA
DGTMGCGRRADSFKFYMAWIYFGQNGFAKRVDHAFDIAKRFVDLISADKRFELVLGSPEN
PPPCLQVCFYFRPSHWTNEDHSEVTRYISRELHKQGKYLVDFSPNPQPGQEKKGEFFRVV
FNSPILTDKVVADLVKSIVEIGQDYGQKE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgaaacgatagaatgcgatttggagtcgtacagaacagaagaactcgattct
ttgctcaaacaactccagcctagaattttggactacatatccaaagcggatccgagccgg
gacgagtaccaagaggactcacttggacgttaccatagtcctcaatttctcaaaaaggag
tttactgacgatgccaagttgcaaagtgggatcaggaaacacccccaggaagtttttgag
gtgattgacaaagtgcttgagtactctgtaaatacatggaatcctggttttttggataaa
ttatatgcatctaataatcctataggagtggtttctgacatcattttgtcggtcttaaac
acaaactcacacgtatacacggtttcaccggtattgtcagtgttggaaaattatattgga
aaaaagtatgctggacttttcttcaaagaccaccaagaaacttgtggaggactcacgttt
tccggcggatcatggtctaatatcacgtctctccagatggcccgcgccatgaagtaccct
gacacgaagattgaaggaaacaatggaagaagatttgcaatttactcgtcaaagcactgc
cattattcggtggaaaaggcagctattttgcttggattgggttcgggttcacttttcaaa
gtggacatattggaagatggaaccatggatgtggctagtttgaagcaagccatcaaaaag
tcgaaactggaaggttacattccattatatgtcaacgcgacagctggaaccacggttttt
ggatcgtacgatccgtttggggaaattgcagccgttgcgaaggagcacaatttgtggttc
catatcgacggatcttggggtggaaacgtgattttttcacctactcatagtgcaaagttg
aagggaagcgaactcgcagactcaataactgtcaaccctcacaagatgcttggggttcct
accacttgttcgttcttattggtgcctcatgtggtggatttccagaacgccatgtctctt
tctgctccatacttgttccatggaagagagaatgaactggaagagaactttgacttggca
gatggaaccatgggttgtggtcgcagagccgattcgttcaagttctacatggcgtggatt
tactttggtcagaacgggtttgccaagagggttgaccatgcgttcgacatagccaaaagg
ttcgttgatttaatcagcgctgataagcggtttgaactagtgttgggaagccctgaaaat
cctcctccatgtctccaggtatgcttctacttccggccttcacactggacgaacgaggac
catagcgaagtcaccaggtacatttcccgggaactacacaagcaaggaaagtatttggtg
gatttttcacccaatcctcaaccaggtcaagaaaaaaaaggggagtttttcagagttgta
ttcaactcaccaatattgaccgacaaggtggtggccgatttggtgaagagtatagttgaa
atcggacaggattatggacaaaaagaataa

DBGET integrated database retrieval system