KEGG   Meyerozyma guilliermondii: PGUG_02362Help
Entry
PGUG_02362        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00730  Thiamine metabolism
pgu00790  Folate biosynthesis
pgu01100  Metabolic pathways
Module
pgu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PGUG_02362
   00790 Folate biosynthesis
    PGUG_02362
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PGUG_02362
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGUG_02362
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pgu00537]
 Enzymes
  PGUG_02362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 5126456
NCBI-ProteinID: XP_001484633
UniProt: A5DGG1
LinkDB All DBs
AA seq 538 aa AA seqDB search
MEKLPLSTGRGHPRKLPARRTMEVLLLVVLGVLTIISGTRLISPTIVASPKSKTNVIMMV
TDGMGPASLSLTRSFRQYRDKLPIDDTLLLDKYLIGSSRTRSSSSLVTDSAAGATAFSCG
LKSYNGAIGVDPSKNPCGTILEALKLEGYLTGLVVTTLITDATPAAFSTHVDYRFQEDLI
AEQQLGEYPLGRTLDLMIGGGRCHYLPTSEEDGCRTDSRNLIEEVQKNGSWNYVGNRKEF
DQLDGGNNVSLPLLALLAPRDIPFDIDRDSKEHPSLAEQVKTALTALSKATENSDKGFFL
MIEGSLIDHAGHMNDPAAQVREVLAYDEAFAEVIKFIDNSDTETIAISTSDHETGGLVTA
RQVSPTYPDYLWYPGVLLNCTHSGEYLANKITNFKDAHSFESFLIKEVLEGDMGIYDYTN
EEVSLIKQSANNPANLLYVLNNMISLRSQTGWTTHGHSAVDVNIYAHTNSERIRRQLLQS
QPYSGLLGNHENIEIGAFMQKITNVDLKKVTELIKDTKHSPSAQSEVRLKGDLHANSY
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggagaaattacccctttccactggccgtggacatccacgcaagctgcctgccaggcgc
acaatggaagtgcttctacttgtagtgctaggagttttgactatcatttctggaactaga
ttgatttccccaaccatcgttgcgagtcccaaatcgaaaactaacgtcataatgatggtc
accgatggcatgggaccggcttccctttcgctcactcgctcatttagacagtacagagac
aagttgcccattgacgatacgttgttgcttgataaatacttgattggttcgtcgagaact
cggtccagttcgtctttggtgacggactcggccgctggagctaccgctttttcttgtgga
ctcaaatcttacaatggagccattggagtggatccctcgaagaatccgtgcggtacaatc
ttggaagctttgaaacttgaagggtatctcaccggtcttgtggtgaccactctcatcacc
gatgctactcctgccgctttcagtactcatgtcgactacaggttccaggaggatttgatt
gccgagcagcagttgggagaatatccattgggaaggactcttgacttgatgattggcggt
ggaagatgtcattatttgcctacctcagaagaggatggatgcagaaccgactcccgcaac
ttgattgaagaggtgcaaaaaaatggttcgtggaactatgtgggaaatagaaaggagttt
gaccaattggacggtggaaacaatgtgtctcttcctttgttggcgttgttggctcctcgt
gatattccttttgatatcgatcgtgattccaaagaacacccatcgcttgctgagcaagtg
aagaccgcattgaccgcattatccaaagccactgaaaattcagacaagggatttttcttg
atgatagaaggatctttgatcgaccatgctggacatatgaatgatccagctgctcaggtg
cgtgaggttttggcttacgacgaggcattcgcagaggttatcaaattcatcgacaattct
gatacggaaactattgccatttccacctcagatcatgagaccggtggccttgtgactgca
agacaggtgtctcccacgtatccagactacttgtggtatcctggagttttgttgaactgc
actcattccggagagtacttggcgaataagattaccaacttcaaagatgctcattcgttc
gagtcgtttctcatcaaagaagtgttagaaggtgacatgggaatttacgactacaccaac
gaggaggtttcgttgataaaacaatcggccaataatccagcaaacttgttgtatgttctc
aacaatatgatttccctcagatcgcaaactggctggacgacgcatggccactctgccgtg
gatgtcaacatttatgcccacaccaactctgagagaattagacgccagttattgcagtcg
caaccgtacagtggacttcttggaaaccacgaaaacatcgagattggcgcctttatgcaa
aaaatcaccaatgtcgatttgaaaaaagtcaccgagttaatcaaggataccaagcattct
ccctcagcacaatctgaagtgcgtttgaaaggcgacctacatgcgaattcgtattaa

DBGET integrated database retrieval system