KEGG   Meyerozyma guilliermondii: PGUG_03276Help
Entry
PGUG_03276        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PGUG_03276
Enzymes [BR:pgu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PGUG_03276
Transporters [BR:pgu02000]
 Other Transporters
  Pores ion channels [TC:1]
   PGUG_03276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_N_4 MetRS-N GST_C_2
Motif
Other DBs
NCBI-GeneID: 5125883
NCBI-ProteinID: XP_001483895
UniProt: A5DJ25
LinkDB All DBs
AA seq 238 aa AA seqDB search
MAAISSPISNRLLLINFTSVQLFNNMSTQLKLYTAKTPNGIKVSILLELLGLKYDYQQLS
IANNGTKEPWFIAKNPNGRIPTLEDKSTGITISESGAILQYLVDTYDKDHKFSYKHGTKE
YYLQLETLFWQMAGLGPMQGQANHFKIYAPETVPYGINRYINETKRLYSVLEIFLKNNEK
NGPYLVGDHLSISDIASFGWAKAAEKLGISFSEWPLVDKWFKNIDSIPEVQKGIDFDS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgatttcttcaccaattagtaatcgtctactccttataaacttcacttctgtc
caacttttcaacaacatgtctactcaattgaaactctacactgccaagactcccaatggg
atcaaagtctccattcttcttgagcttcttggcttgaaatatgactaccagcaactcagt
attgccaacaatggaacgaaagaaccttggtttattgccaaaaaccccaatggcagaatt
ccaactttggaggacaagtctactggaatcaccatcagtgaatctggagcaattttgcag
tacttggtcgacacttacgacaaggaccataagttttcgtacaagcatggtaccaaggag
tactatttgcaattggagacccttttttggcagatggcaggattgggaccaatgcaggga
caggccaatcatttcaagatctatgctccggaaacggttccttatggtatcaaccggtat
attaatgaaaccaagagattgtattccgttcttgagattttcttgaaaaataacgaaaag
aacggtccctatttggtgggtgatcacttgagtatcagtgacattgcgagcttcgggtgg
gctaaagccgccgaaaaattgggtatctcgtttagcgaatggcctttggttgacaaatgg
tttaagaacattgattcgatccccgaggttcaaaagggtattgattttgattcgtaa

DBGET integrated database retrieval system