KEGG   Meyerozyma guilliermondii: PGUG_03659Help
Entry
PGUG_03659        CDS       T01150                                 

Definition
(RefSeq) isocitrate dehydrogenase, mitochondrial precursor
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00020  Citrate cycle (TCA cycle)
pgu00480  Glutathione metabolism
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
pgu01130  Biosynthesis of antibiotics
pgu01200  Carbon metabolism
pgu01210  2-Oxocarboxylic acid metabolism
pgu01230  Biosynthesis of amino acids
pgu04146  Peroxisome
Module
pgu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PGUG_03659
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PGUG_03659
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PGUG_03659
Enzymes [BR:pgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PGUG_03659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 5126208
NCBI-ProteinID: XP_001484278
UniProt: A5DK58
LinkDB All DBs
AA seq 437 aa AA seqDB search
MLRSIGYTKPLSGGSRMTQATTISNGIRYLATGSKIKVKNPIVELDGDEMTRIIWQRIKD
KLIHPYLDVDLKYYDLGIEARDKTDDQITIDAAHAIQKYGVGVKCATITPDEARVKEFGL
KKMWLSPNGTIRNILGGTVFRESIVIPRVPRLVPGWKLPIVIGRHAHGDQYKATDLVVSG
PGKLELKFTPKDGGESETRVVYDYQGPGVGLAMYNTDESIRGFAHSSFKMALSKKLPLYM
LTKNTILKKYDGRFKDIFAEVYQEYQSEFEAQGLWYEHRLIDDMVAQMMKSQGGFVMALK
NYDGDVQSDIVAQGFGSLGLMTSVLMTPDGKAFESEAAHGTVTRHFRQHQQGKETSTNSI
ASIFAWTRGLAQRGRLDNTPEVVEFAERVEKATVDTVDKQGIMTKDLAIACGNLDRSAYV
TTTEFLDAVADSVANSK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgttgagatcgattggatacaccaaaccgctttctgggggctccagaatgacccaagca
accaccatttccaatggtatccgttatcttgcaacaggttcaaaaatcaaagtgaaaaat
ccaattgtcgagttggatggagatgaaatgacgagaattatttggcaaagaatcaaggat
aagcttattcacccctaccttgatgtggacttgaagtactatgatctcggaattgaagcc
agagacaaaactgatgatcagattaccatagatgctgctcatgctatccaaaagtacgga
gtcggagtcaagtgtgctacaattactccagatgaggctcgtgttaaggagtttggactc
aagaaaatgtggctttcacccaatggaaccatcagaaacattttgggaggaaccgttttc
agagaatcaattgtgattcctagagttccccggttggttcccggctggaaactgcccatt
gtgattggtagacacgcccacggcgaccagtataaggccaccgacttggttgtttctgga
cctggaaagttggagttgaaatttactcccaaggacggtggagagtctgagaccagagtg
gtttacgactaccagggaccaggagttgggttggcaatgtacaataccgacgagtcgatt
cgagggtttgcacactcgtcgttcaagatggctctttccaagaagttgcctctttatatg
ctgacgaaaaacaccattttgaaaaaatacgacggtagattcaaggacatttttgccgag
gtgtatcaggagtaccagtcggaattcgaggcccagggcttgtggtacgaacacagactc
attgacgacatggtggctcaaatgatgaagtcacagggtggatttgtcatggctttgaag
aactacgatggagatgttcaatctgatattgtagcccaaggttttggttcgctcggcttg
atgacttcagttttgatgacacccgatggaaaggcttttgaaagtgaagctgctcatgga
actgttaccagacactttagacagcaccagcaaggaaaggaaacatccaccaactcaatt
gcatctatttttgcctggactcgaggtcttgctcaacgtggacgtcttgataacacacct
gaggtggtggagtttgctgagagagtagagaaagccaccgttgatacggtggacaagcag
ggaattatgaccaaagatttggccattgcttgtggtaaccttgaccgttctgcctacgtc
accaccacggagtttctcgatgcggttgctgattctgtagctaatagcaagtag

DBGET integrated database retrieval system