KEGG   Meyerozyma guilliermondii: PGUG_05465Help
Entry
PGUG_05465        CDS       T01150                                 

Definition
(RefSeq) similar to succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00020  Citrate cycle (TCA cycle)
pgu00190  Oxidative phosphorylation
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
pgu01130  Biosynthesis of antibiotics
pgu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PGUG_05465
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PGUG_05465
Enzymes [BR:pgu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PGUG_05465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 5124128
NCBI-ProteinID: XP_001482445
UniProt: A5DQB4
LinkDB All DBs
AA seq 641 aa AA seqDB search
MLSVAKIGRAEARWAISRSFASSAIRSQTIGDIKGKDVNASKYMSQKYHVIDHEYDCVVV
GAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGINAALGNMHKDDWHWHMYDTV
KGSDWLGDQDAIHYMTKEAPQSIYELENYGVPFSRNEEGRIYQRAFGGQSKEYGKGGQAY
RTCAVADRTGHALLHSLYGQSLRHDTHFFIEFFAMDLLMQDGACVGVIAYNEEDGTLHRF
RAHRTVIATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLEDLEFVQFHPSGIYGSGCLI
TEGARGEGGFLVNSEGERFMERYAPSAKDLASRDVVSRAITMEINEGRGVGPHKDHMYLQ
LSHIPAAVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTKWNGEVLKKNEK
GEDEVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAVSHTIRDNLTPNTPHKPMPQ
DLGVESIENLDRLRNANGTHSTADLRLEMQKTMQKGCAVFRTQETLDEGVEHILKVDKKF
HDVKTTDRSMIWNSDLVETLELQNLLTCATQTAVSAAARKESRGAHARDDYPERDDENWR
KHTLSYQTGFGEEVKLDYRDVIRTTLDENDCKPVPPAKRVY
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgctttctgtggccaagataggacgcgctgaggcacggtgggccatctccaggtcgttt
gcatcgtcggctataagaagccaaaccattggtgatattaagggaaaagatgttaatgct
tccaaatacatgagccaaaagtatcatgtcattgatcatgaatatgactgtgtagtggtc
ggagctggtggagctgggttgagagctgctttcggacttgccgaggctgggttcaagact
gcttgtatttccaaattgttccctactagatctcatacggttgctgctcagggaggtatt
aatgctgcccttggaaacatgcacaaggatgactggcactggcacatgtatgacacggtc
aagggttctgattggttgggagaccaggatgctatccattacatgaccaaggaggcgcct
cagagtatttacgagttggaaaattacggtgttccattttccagaaatgaagaaggtcgt
atctaccagcgtgcctttggcggtcagtccaaggagtacggaaagggtggtcaggcgtac
agaacgtgtgcggtggctgacagaacaggacatgcacttttgcattcgctttatggccag
tcgttgagacacgatacccattttttcatcgagtttttcgcgatggatcttcttatgcaa
gatggagcctgtgtgggtgtgattgcctacaacgaggaggacggaaccctccatcggttc
agagcccatagaaccgtgatagctaccggaggttacggtcgtgcttacttttcgtgtacc
tcggctcacacctgtaccggagacggttacgccatggtttcgagagccgggcttccattg
gaggacttggagtttgtgcaattccatccttctggtatttatggttcgggatgtttgatc
accgagggtgctcgtggtgaaggtggtttcttggtcaactccgagggtgagcgtttcatg
gaaagatacgcaccttccgccaaggatttggcttccagagacgtggtttctcgtgccatc
accatggaaattaatgagggtcgtggtgtgggacctcacaaggaccacatgtaccttcaa
ttgtcgcatattcctgctgcagttcttaaagaaagattgccaggtatttccgaaaccgct
cacattttcgccggtgtcgatgtcaccaaggaacccatccctatcttgcccactgtccac
tacaatatgggaggtattccaaccaagtggaacggagaggtgttgaagaagaacgaaaag
ggtgaagacgaggttgttcccggtttgttggcgtgtggtgaagccgcttgtgcttctgtt
cacggtgccaaccggttgggtgccaactcgttgttggacttggttgtgtttggtcgtgct
gtttcgcacaccattcgtgacaacttgaccccaaatactccccacaagcctatgcctcag
gatctcggagtcgagtcgattgaaaacttggacagattgagaaacgccaacggaacccac
tcaactgcagacttgcgtttggaaatgcaaaaaacaatgcagaagggatgtgccgttttc
agaacccaggagactttagacgagggtgtagagcatattttgaaggtggacaagaagttc
catgatgtcaagaccaccgatagatcgatgatttggaactctgatttggtggaaaccttg
gaattgcaaaacttgttgacttgtgccacccaaaccgcggtttctgctgccgccagaaag
gagtctcgtggtgctcatgccagagacgattacccagaaagagacgatgaaaactggaga
aagcacacattatcgtaccagactggattcggtgaagaagtcaagttggactacagagat
gtgatcagaacgaccttggatgagaacgactgtaagccagttcctcctgccaagagagtg
tactag

DBGET integrated database retrieval system