KEGG   Polymorphum gilvum: SL003B_0449Help
Entry
SL003B_0449       CDS       T01458                                 

Definition
(GenBank) Putative ribonuclease rnase bn (Rbn) transmembrane protein
  KO
K07058  membrane protein
Organism
pgv  Polymorphum gilvum
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    SL003B_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ADZ68884
UniProt: F2J314
LinkDB All DBs
Position
453835..454710
Genome map
AA seq 291 aa AA seqDB search
MTLSKRLVIGYRVLGDALGHFNRDDGWAMASHVALSSLLALFPLLIFIAALAGFLGLTGT
AARVSELIFEAWPEQVAAPVANEIKKVLTVPRGDLLTFGVVAALWFASNGVEAVRVALNR
AYRVIDTRPFVLLRLQSILLVLLCSIGLIAFTFLMVLAPLALAAAHAWFPWLADFAGRIN
AVRYGAASLVAVAGLIVVHAVLPAGRRRFVDILPGVAATLALWLAAGAAFGAYLAGYADY
VSTYAGLAGVMSALVFLYIVALALLIGGELNAALIRQRDLRRETAGAGAGG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgtcgaagcgacttgtgatcggataccgcgtgctcggcgacgcgctcggccat
ttcaaccgggacgacggctgggcgatggcgagccacgtggcgctgtcgtcgctgctggcg
ctgttcccgttgctgatcttcatcgcggcgctggccggcttcctcggcctcaccggaacc
gcggcgcgggtgtcggagctgatcttcgaggcctggccggagcaggttgccgcaccggtc
gccaacgagatcaagaaggtgctgacggtgccgcgcggggacctgctgaccttcggtgtg
gtggcggcgctgtggttcgcctccaacggggtcgaggcggtgcgggtggcgctcaaccgt
gcctatcgggtgatcgacacgcgccccttcgtgctgctgcggctgcaatctatcctgctc
gtgctcctgtgctcgatcgggctgatcgccttcacgttcctgatggtgctggcgccgctg
gcgcttgccgccgcgcacgcctggttcccgtggctggccgatttcgctggccgcatcaat
gcggtgcgctacggggcagcgagtctcgtcgccgtcgccggcctgatcgtcgtccacgcg
gtgctgccggccggccggcggcgcttcgtcgacatccttccgggggtggcggcgacgctg
gcgctgtggctggcagccggcgcggccttcggcgcctatcttgccggctatgccgattac
gtgtcgacctacgccggacttgccggcgttatgtcggctctggtgttcctctacatcgtg
gcgctggcgctgctgatcggcggcgaactcaacgccgcgctgatccgccagcgcgacctc
aggcgggagacggccggcgctggcgccggcggatga

DBGET integrated database retrieval system