KEGG   Polymorphum gilvum: SL003B_0723Help
Entry
SL003B_0723       CDS       T01458                                 

Gene name
accC
Definition
(GenBank) Biotin carboxylase / acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00061  Fatty acid biosynthesis
pgv00620  Pyruvate metabolism
pgv00640  Propanoate metabolism
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
pgv01120  Microbial metabolism in diverse environments
pgv01130  Biosynthesis of antibiotics
pgv01200  Carbon metabolism
pgv01212  Fatty acid metabolism
Module
pgv_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SL003B_0723 (accC)
   00640 Propanoate metabolism
    SL003B_0723 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SL003B_0723 (accC)
Enzymes [BR:pgv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SL003B_0723 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SL003B_0723 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATPgrasp_ST RimK
Motif
Other DBs
NCBI-ProteinID: ADZ69153
UniProt: F2IVP6
LinkDB All DBs
Position
762033..763409
Genome map
AA seq 458 aa AA seqDB search
MLRKLLVANRGEIAVRVIRAARDLGIATVAVYSDADRDALHVQLADEAVHIGPPAPKKSY
LDIGAILQAAVDTGCDSVHPGYGFLAENAAFSDAVAAKGLVFVGPSGDAIRLMGDKVAAR
SAAHAAGVPVVPGSMGRVASIEEARAILIDTGFPVMIKAAAGGGGRGIRIANNLAEFEKA
FPQAAAEALAAFGDGGLYMEKVIGRARHIEVQVLGDGADAVHCFERECSLQRRRQKVWEE
APSLALSDKVREELCASAVRLARAVGYSGAGTIEYLYDDAEDRFYFIEMNTRIQVEHPVT
EMITGIDLVAEMLRIAGGEPLRLRQRDIAVSGHAIEVRINAEDPARDFVPFPGTVGDLRV
PGGPGVRFDSMLYPGYAVPPFYDSLLAKLIVHGETREAAIVRLVRALAELRIAGLKTTKP
LFTALAADPAVQAADVHTRWLESWLDQHAGTLIPDPET
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaagcttctggtcgccaaccggggcgaaatcgcggtgcgggtgatccgtgcc
gcgcgcgatctcggcatagcgaccgtggcagtctattcggacgccgaccgagacgcgctg
catgtgcaactcgcggatgaggcggtccacatcggtccgccggccccgaagaaaagctat
ctcgacatcggcgccatcctgcaggcggcggtcgacaccggttgcgacagcgtccatccg
ggttacgggttcctggccgagaatgccgctttttccgacgcggtcgccgcgaaggggctg
gtgttcgtcggtccctcgggggatgctatccgcctgatgggcgacaaggtagcggcacgc
tcggctgcccatgcggcgggcgtaccggtggtgccgggctccatggggcgggtggcatcc
atcgaggaagcccgcgcgatcctgatcgataccggctttccggtgatgatcaaggccgcg
gccggtggcggcggccggggcatccgcatagccaacaatctcgccgagttcgagaaggcg
tttccgcaggctgccgccgaggcgctcgccgccttcggcgacggcggcctctacatggaa
aaggtcatcggccgggcccggcacatcgaggttcaggtccttggcgatggcgccgatgcg
gtgcactgcttcgaacgcgaatgctcgctgcagcggcgccggcagaaggtctgggaagag
gcgccgtcgctggccttgtccgacaaggtgcgagaggagctgtgcgcgtccgcggtgcgc
cttgcccgcgccgtcggctattccggcgccgggacgatcgaatacctctacgacgatgcc
gaagatcgcttctatttcatcgagatgaacacccgtatccaggtcgagcatccggtgacc
gagatgatcaccggcatcgatctggtcgccgagatgctccggattgcaggcggcgagcct
ctgcggctgcgccagcgcgacatcgccgtcagcggtcacgcgatcgaggtccggatcaac
gcggaagaccctgcgcgcgatttcgtgccctttcccggcacggtgggcgacttgcgtgtg
ccaggcggcccaggtgttcggttcgattccatgctttacccgggatatgcggtcccgccc
ttctacgattcgcttctggccaagctcatcgtgcacggcgaaacgcgcgaggctgccatc
gtccgcctcgtgcgcgccttggccgagttgcgtatcgcgggcctcaagacgaccaagccg
ctgttcaccgctctggccgccgatcccgccgtgcaggctgcggacgtgcacacgcggtgg
cttgaatcctggctcgaccagcatgctggcaccctgatccccgaccctgaaacctga

DBGET integrated database retrieval system