KEGG   Polymorphum gilvum: SL003B_0988Help
Entry
SL003B_0988       CDS       T01458                                 

Gene name
rbcL
Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00630  Glyoxylate and dicarboxylate metabolism
pgv00710  Carbon fixation in photosynthetic organisms
pgv01100  Metabolic pathways
pgv01120  Microbial metabolism in diverse environments
pgv01200  Carbon metabolism
Module
pgv_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pgv_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SL003B_0988 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SL003B_0988 (rbcL)
Enzymes [BR:pgv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SL003B_0988 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ADZ69417
UniProt: F2IXT6
LinkDB All DBs
Position
complement(1056747..1058204)
Genome map
AA seq 485 aa AA seqDB search
MDAKMKEIKGKERYKAGVLKYAQMGYWDGDYEPKDTDVIALFRITPQDGVDPIEAAAAVA
GESSTATWTVVWTDRLTACDSYRAKAYRVDPVPGTPGQYFCYVAYDLILFEEGSIANLTA
SIIGNVFSFKPLKAARLEDMRFPVAYVKTYKGPPTGIVVERERLDKFGKPLLGATTKPKL
GLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLYCMEAVNKASAETGEVKGH
YLNITAGTMEEMYRRAELAKELGSVIVMVDLIIGWTAIQSISEWCRQNDMILHMHRAGHG
TYTRQKNHGISFRVIAKWLRLAGVDHLHCGTAVGKLEGDPLTVQGYYNVCRETRNAVDLP
RGIFFEQDWADLRKVMPVASGGIHAGQMHQLLDLFGDDVVLQFGGGTIGHPMGIQAGATA
NRVALEAMVLARNEGRDIVNEGPEILRAAAKWCKPLEAALDTWGSITFNYTSTDTSDFVP
TPAVA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggacgccaagatgaaggaaatcaaaggcaaggaacgctacaaggccggcgtgctgaaa
tacgcccagatgggctactgggacggcgactacgagcccaaggacacggacgtcatcgcc
ctgttccgcatcacgccgcaggacggcgtcgatccgatcgaggcggccgccgctgtcgcc
ggcgaaagctcgactgcgacctggaccgtggtgtggaccgaccggctgaccgcctgcgac
agctaccgcgccaaggcctaccgggtcgacccggtgccgggcacgccgggccagtacttc
tgctacgtcgcctacgacctgatcctgttcgaggaaggctcgatcgccaacctgaccgcc
tcgatcatcggcaacgtgttctcgttcaagccgctcaaggcggcgcggctggaggacatg
cgcttcccggtcgcctacgtgaagacctacaagggcccgccgaccggcattgtcgtcgag
cgcgagcggctcgacaagttcggcaagccgctgctcggcgccacgaccaagccgaagctc
ggcctgtcgggcaagaactacggccgcgtcgtctacgagggcctgaagggcggcctcgat
ttcatgaaggacgacgagaacatcaactctcagccgttcatgcactggcgcgaccgtttc
ctgtactgcatggaggccgtcaacaaggccagcgccgagaccggcgaggtcaagggccac
tacctcaacatcaccgccggcacgatggaggagatgtaccggcgcgccgaactcgccaag
gaactcggctcggtgatcgtcatggtcgacctgatcatcggctggacggcgatccagtcg
atctcggaatggtgccggcagaacgacatgatcctgcacatgcaccgcgccggccacggc
acctacacgcgccagaagaaccacggcatctcgttccgcgtcatcgccaagtggctgcgg
cttgccggcgtcgaccacctgcattgcggcacggccgtcggcaagctcgaaggcgatccg
ctgaccgttcagggctactacaacgtctgccgcgagacgcggaacgcggtcgacctgccg
cgcggcatcttcttcgagcaggactgggccgacctgaggaaggtcatgccggtcgcctcc
ggcggcatccatgccggccagatgcaccagctgctcgacctgttcggcgacgacgtcgtg
ctgcagttcggcggcggcaccatcggccatccgatgggcatccaggcgggcgcgacggcc
aaccgcgtggcgctcgaggccatggtgctggcccgcaacgaaggccgcgacatcgtcaac
gaggggccggaaatcctgcgcgccgccgccaagtggtgcaagccgctggaggccgcgctc
gatacctggggctcgatcaccttcaactacacctcgaccgacacctcggacttcgtgccg
acgccggcggtcgcctga

DBGET integrated database retrieval system