KEGG   Polymorphum gilvum: SL003B_1064Help
Entry
SL003B_1064       CDS       T01458                                 

Gene name
glpD
Definition
(GenBank) FAD dependent oxidoreductase, putative
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00564  Glycerophospholipid metabolism
pgv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SL003B_1064 (glpD)
Enzymes [BR:pgv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SL003B_1064 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 NAD_binding_8 Pyr_redox_2 GIDA
Motif
Other DBs
NCBI-ProteinID: ADZ69493
UniProt: F2IYP6
LinkDB All DBs
Position
1139859..1141475
Genome map
AA seq 538 aa AA seqDB search
MTRGSNDDVPVDLFVIGGGINGCGIARDAAGRGLSVALAEQGDLASATSSASTKLFHGGL
RYLEYFEFRLVREALIEREVLLAAMPHISWPMRFVLPYHKDMRFEAETPTSRLLGVVMPW
MKGRRPAWLIRLGLFLYDHLGGRRILPGTATVDLARDPAGAPLQDRFSHAYEYSDCWVED
SRLVVLNARDAAACGAEILVRTEVVSARVEDGLWTLVLRDADTGETATRRARMAVNAAGP
WVEQVLRGTLGIDTGEGVRLVRGSHIVTRRLYDHDKCYFFQGEDGRIIFAIPYETDFTLI
GTTDADHTDASVRPECTPEERDYLLRFASAYFRTPVTADDVVWTYSGVRPLYDDGASSAT
AATRDYVLSVDTAAGAPLLTVFGGKITTYRRLAESALDKIAPFFDAVPGPWTAGVALPGG
DFPVDGVAELIAELQAAYPFLDAAWARRLVRAYGTEAADMLGDARSDADLGRPFGASLTE
REVRWLMEREFARRAEDVVWRRSKLGLRLSADAIAALDAFMTGSAAGAGADRAAASGL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
gtgacacggggttccaacgacgacgtgccggtcgatctgttcgttatcggcggcggcatc
aacggctgcggcatcgcgcgcgacgccgccgggcgcgggctttcggtcgcgctggcggag
cagggcgatctcgcctcggcgacctcgtcggcctcgaccaagctgttccacggcggcctg
cgctatctggaatatttcgagttccgcctcgtgcgcgaggcattgatcgagcgcgaggtt
ctgctcgccgccatgccgcacatcagctggccgatgcgcttcgtgctgccctatcacaag
gacatgcggttcgaggccgagacgccgacgtcgcggctgctcggcgtcgtcatgccctgg
atgaagggccgccgcccggcctggctgatccggctcggcctgttcctctacgaccatctc
ggcgggcgcaggatcctgccgggtaccgcgacggtcgaccttgcccgcgatccggccggg
gcgccgctgcaggaccgattctcgcatgcctacgaatattccgactgctgggtggaggat
tcgcgcctcgtcgtgctcaacgcccgcgacgcggccgcatgcggggcggagatcctggtg
cgcaccgaagtcgtctcggcacgcgtcgaggacgggctgtggacgctcgtcctgcgcgac
gccgacacgggcgagacggcgacgcggcgcgcgcgcatggcggtcaatgccgccggcccc
tgggtggaacaggtgctgcgcggcacgcttggcatcgacaccggcgagggcgtgcggctg
gtgcgcggcagccacatcgtcacgcgccggctctacgaccacgacaagtgctacttcttc
cagggcgaggacgggcggatcatcttcgccattccctacgagaccgatttcacgctgatc
ggcacgacggacgccgaccacacggacgcttccgtcaggcccgagtgcacgcccgaggag
cgcgactacctgctccgcttcgcatcggcctatttccgcacgccggtcaccgccgacgac
gtggtgtggacctattcgggcgtccggccgctctacgacgacggcgcatcctcggcgacg
gccgcgacacgggactacgtgctgagcgtagacacggcggccggcgcgccgctgctcacc
gtgttcggcggcaagatcaccacctatcggcggctggcggaatccgcgctcgacaagatc
gcgccgttcttcgacgcagtcccgggtccctggaccgcgggtgtggcacttccgggcggc
gacttcccggtcgacggggtggcggagctgatcgcggagctgcaggcggcctatccgttc
ctggatgccgcctgggcgcgccgcctggtgcgtgcctacggcacggaggctgccgacatg
ctgggcgacgccagaagcgatgccgatctcggtcgaccgttcggggcatcgctgacggag
cgcgaggtgcgttggctgatggagcgcgagttcgcgcgccgcgcagaggatgtcgtctgg
cggcggtcgaagctcggcctgcgcctgtccgcggacgcgatcgccgcgctggacgccttc
atgaccggcagtgcggcgggagccggggcagaccgcgccgccgcttccggtctatag

DBGET integrated database retrieval system