KEGG   Polymorphum gilvum: SL003B_1212Help
Entry
SL003B_1212       CDS       T01458                                 

Definition
(GenBank) putative thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00240  Pyrimidine metabolism
pgv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SL003B_1212
Enzymes [BR:pgv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SL003B_1212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: ADZ69641
UniProt: F2J0H3
LinkDB All DBs
Position
complement(1296996..1297598)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSSMNAGKSTVLLQASYNYAERGMTALLLTAAVDDRAGHGKIASRIGLAAAAD
TFRNDDDLFGHVSAALAKRPIHAVFVDEAQFLTETQVWQLASVADTLAIPVMCFGLRTDF
QGRLFPGSQALLAIADSLKEIKTICWCGRKATMVARLDAAGRVVEEGEQVVIGGEESYVS
LCRRHWVDRDLGSGAQAAGE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttacttcaactattcctcaatgaacgccggcaagtcgacggtcctgctg
caggcgtcttacaactatgccgaacgcggcatgacggccctgctgctgaccgctgccgtg
gacgaccgggccggacacggcaagatcgcttcgcgcatcggtctagccgccgcggccgac
accttccgcaacgatgacgacctttttggtcatgtgtccgcagcccttgccaagcggccg
atccacgccgtcttcgtcgacgaggcgcagtttctgaccgagacacaggtctggcagctg
gcaagcgtcgccgacacgctcgccatcccggtgatgtgcttcggcctgcgcacggacttc
cagggccggctgttccccggcagccaggcgttgctggcgatcgccgacagcctgaaggaa
atcaagacgatctgctggtgtggtcgcaaggcgacgatggtcgcccggcttgacgccgcc
gggcgcgtcgtggaggaaggcgaacaggtggtgatcggcggcgaagagtcctatgtttcg
ctgtgccggcgccattgggtcgatcgggacctcgggtcgggcgcgcaagccgccggcgaa
tga

DBGET integrated database retrieval system