KEGG   Polymorphum gilvum: SL003B_1830Help
Entry
SL003B_1830       CDS       T01458                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SL003B_1830
Enzymes [BR:pgv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SL003B_1830
Transporters [BR:pgv02000]
 Other Transporters
  Pores ion channels [TC:1]
   SL003B_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ADZ70256
UniProt: F2IVX4
LinkDB All DBs
Position
1918518..1919174
Genome map
AA seq 218 aa AA seqDB search
MAIQDEIVLYYSPQTRATGTRILLEELGAPYRLHVLNMKAGENRAPAYLQVNPLGKVPAI
RHGDALVTEQVAITIYLADLFPQAGLAPAIGDPLRGPYLRWIAFYGSCFEPAVTDRSMQR
EPAPASRSAYGTYEDVIGLLEAQLKRGPYLLGARYTAADVLWAVALHWTMMFGLVPNGSA
FADYVKRVAARPSFAKVGEEDAALAAEHEAAAAVRPAS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcaatccaggacgagatcgttctctactattcgccgcagacgcgggcgaccggcacg
cgcatcctgctggaggaactgggcgcgccctaccggctgcacgtgctcaacatgaaggcg
ggcgagaaccgcgcccctgcctatcttcaggtcaatccgctcggcaaggtgccggcgatc
cgtcacggcgacgcgctcgtcaccgaacaggtggcgatcaccatctacctggcggacctg
ttcccgcaggcggggctcgctccggcgatcggcgatccgctgcgcgggccctacctgcgc
tggatcgccttctacggctcctgcttcgagccggcggtgaccgaccggtcgatgcagcgc
gagccggcgccggccagccggtcggcctacggcacctatgaggacgtgatcgggctgctg
gaagcacagctcaagcgcggcccttatctcctcggcgcgcgctacacggccgcagatgtc
ctgtgggccgtcgcgctgcattggacgatgatgttcggtctcgtgcccaacgggtccgcc
tttgccgactacgtcaagcgcgtcgcggcccggccgagcttcgccaaggtgggggaggaa
gacgcggcgctcgccgccgaacacgaggccgccgcagcggtccgaccggcttcttaa

DBGET integrated database retrieval system