KEGG   Polymorphum gilvum: SL003B_1902Help
Entry
SL003B_1902       CDS       T01458                                 

Definition
(GenBank) Uracil DNA glycosylase superfamily
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
pgv  Polymorphum gilvum
Pathway
pgv03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SL003B_1902
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pgv03400]
    SL003B_1902
Enzymes [BR:pgv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SL003B_1902
DNA repair and recombination proteins [BR:pgv03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SL003B_1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ADZ70328
UniProt: F2IWK3
LinkDB All DBs
Position
1997990..1998658
Genome map
AA seq 222 aa AA seqDB search
MISDTPAADRCDPPLDCDRCPRLVAFRHEHQRAFPNWFNAPVPSFAAPDPRLLVVGLAPG
LRGANRTGRPFTGDYAGDLLYETMLDFGFARGRYEARPDDGLELVGAAITNAVRCVPPAN
KPVGSEIANCRSFLFATLDAYPGLRAVLALGRIAHETFLSTLDIRRADFAFGHGRRHDLG
TRSLVLFDSYHCSRYNTNTGRLTREMFRAVFADMRCFLDETA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttgatctcggacacgccggcggcggatcgttgcgatccgccgctcgactgcgaccggtgt
ccccggctggtagcgttccgccatgaacaccagcgtgcctttcccaattggttcaatgcg
ccggtgccgagcttcgccgccccggacccccggctgctggtggtcggtctcgcgcccggc
ctgcgcggcgccaaccgcaccggacggccgttcaccggcgactatgccggcgatctcctc
tatgaaaccatgctggatttcggcttcgcccgtggccgttacgaggcgcgcccggacgac
gggctggagctcgtcggcgcagcgatcaccaatgccgtgcgctgcgtacctccggccaac
aaaccggtcggcagcgagatagctaattgtcggtcgttcctgtttgccaccctcgacgcg
tatcccggcctgcgcgcggtgctggcgctcgggcgcattgcgcacgagacctttctgtcg
acactcgacatccggcgtgccgacttcgccttcggccatggtcgaaggcacgacctcggc
acgcgctccctggttctgttcgacagctaccattgctcccgctacaacaccaacactggc
cgtctgacgcgcgagatgttccgcgccgtgttcgccgacatgcgctgcttcctcgacgag
accgcatag

DBGET integrated database retrieval system