KEGG   Pantoea gaviniae: C2E15_01665Help
Entry
C2E15_01665       CDS       T05418                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pgz  Pantoea gaviniae
Pathway
pgz00564  Glycerophospholipid metabolism
pgz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C2E15_01665
Enzymes [BR:pgz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C2E15_01665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 3HCDH_N Pyr_redox_2 Lycopene_cycl GIDA FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AUX91933
UniProt: A0A2L0IBH6
LinkDB All DBs
Position
complement(387399..388907)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRAGLFMYDHLGKRTSLPGS
KGLRFGAESVLKPEISRGFEYSDCWVDDARLVVLNAQEVVKRGGDVRTRTRATRAWRENG
LWMVEAQDVDTGKTYTWRAKGLVNAAGPWVKQLFDDGLKLKSPYGIRLIKGSHIVVPRVH
TEKQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKQVKIDDNEIDYLLKVYNAHF
KKPLDRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVRDDAGKAPLLSVFGGKLTTYRK
LAEHAMEKLAKYYPNAGPAWTKSAVLPGGDIAGTREDYAASLRRRYPFISEGLARHYART
YGSNSEQILQNASSIADLGEDFGHSFHEAELRYLVENEWVRELDDAIWRRTKLGMWLTEA
QQARVAQWLETHSKKPALSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgatcgttatcggcggcggcatcaacggtgccggcattgcggcc
gatgccgcaggacgcggactgtcagtgctgatgctggaggcgcaggatctggcgtgcgcg
acctcctccgccagctcgaaacttatccacggtggcctgcgctatctggagcattatgaa
ttccgcctggtgagcgaagcgctggccgagcgtgaagtgttactgaaaatggcgccgcat
atcgctttccccatgcgtttccgcctgccccaccgcccccacttacgtccggcctggatg
atccgcgccggtctgtttatgtatgaccatctcggcaaacgcaccagcctgccgggcagt
aaagggttgcgttttggcgcggaatcggtgctgaagccagaaatttcgcgcggtttcgaa
tattccgactgctgggtggacgatgcgcgcctggtggtgctgaatgcgcaagaagtggtg
aaacgcggcggcgacgtgcgtacccgcacccgcgcaacccgcgcctggcgtgaaaatggc
ctgtggatggtggaagcgcaggatgtcgacaccggcaaaacctacacctggcgcgccaaa
ggcctggtgaacgccgccggcccgtgggtcaagcagctgtttgacgacggcctgaagctg
aaatcgccgtacggtatccgcctgatcaaaggcagccatatcgtggtgccgcgcgtgcat
actgaaaagcaggcctacatcctgcagaacgaagataaccgtatcgtgtttgtgatcccg
tggatggatgaattctccattatcggcaccaccgacgtggaatataaaggcgatccgaag
caggtgaaaatcgatgataacgaaatcgactatctgctgaaggtgtacaatgcgcacttt
aaaaagccgctggaccgtgacgatatcgtctggacctattccggcgtgcgtccgctgtgt
gatgacgaatcggactcaccgcaggcgattacccgcgactatacgctcgatgtgcgtgac
gatgccggcaaggcgccgctgctgtcggtgttcggcggcaagctgaccacctatcgtaag
ctggctgaacatgcgatggaaaaactggcgaagtattatcccaacgccggtccggcctgg
acgaagagcgctgtgctgccgggcggcgatatcgccggtacgcgtgaagattacgccgcc
agcctgcgtcgccgctatccgtttatcagcgaaggtctggcacgtcactacgcccgcacc
tacggcagcaacagcgagcagatcctgcagaacgccagctcgatagcggatcttggcgaa
gatttcggtcacagcttccacgaagcggaactgcgctatctggtggaaaatgagtgggtg
cgtgaactggacgatgctatctggcggcgcaccaaactcggcatgtggctgaccgaagcg
cagcaggcgcgtgtggcgcagtggctggagacccacagcaagaaaccggccctctctctc
gcttcctga

DBGET integrated database retrieval system