KEGG   Mixta gaviniae: C2E15_04990Help
Entry
C2E15_04990       CDS       T05418                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A
  KO
K22601  oxamate carbamoyltransferase [EC:2.1.3.5]
Organism
pgz  Mixta gaviniae
Pathway
pgz00230  Purine metabolism
pgz01100  Metabolic pathways
pgz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pgz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C2E15_04990
Enzymes [BR:pgz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.5  oxamate carbamoyltransferase
     C2E15_04990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase SHOCT
Motif
Other DBs
NCBI-ProteinID: AUX92495
UniProt: A0A2L0ID24
LinkDB All DBs
Position
complement(1086272..1087681)
Genome map
AA seq 469 aa AA seqDB search
MTLHELSIRQLRQALARGELSAAEIAAATLCAIEQQNPRLNAWTTIVGDRMRREADRLDR
RRREGQPLPPLAGVPYAVKNLFDVAGHPTLAGASLFSDSAPAAHDAWALATLSQAGALLS
GMLNMDAYAYGFTTENSHYGATRNPHDVQRIAGGSSGGSAAAVAAGLAHFTLGSDTNGSI
RVPASLCGVFGLKPTFGRLSRHGTHPFVASLDHIGPFARRSEDLAYVYDALQGHDAQDAF
QANVAVQPVSGQLHRGMEGLRCAVLGGFFRQWSDAEAQQAVATVARALEASEELSIEEVE
IARSAAFIITASEGGNRYLPLLRSQPERFEPLSRERLLAGAMLPAAWYVQAQRFRRHFQQ
QVTALFADVDILIAPATPCSATLMGQESMTINGQTLPVRASMGMLTQPISFLGLPVVTVP
LQTASGLPIGVQLIAAPFQEARCLRAARALEQMGIAAAPVAKGSMSDEL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcatgaactctctattcgccagctgcgtcaggcattggcgcgcggcgagctg
agcgcggcggagatcgccgccgccactctctgcgccattgagcagcagaacccgcgcctg
aacgcctggacaacgatcgtcggcgatcgcatgcgccgggaggcggatcgccttgatcga
cggcggcgcgaggggcagccgctgccgccgctcgccggcgtgccttatgcggtaaaaaat
ctgtttgacgtggcgggccatcccacgctggcgggtgccagtttgttcagcgacagcgcg
cccgccgcgcatgacgcctgggcgctggcgacgctaagccaggccggcgcgctgctcagc
ggcatgctgaatatggatgcctacgcctatggctttaccactgagaacagccactacggt
gccacgcgcaatccgcacgatgtgcagcgtatcgccggcggctcctctggcggttcggcc
gccgccgtggctgccgggctggcgcattttaccctgggaagcgacaccaatggatcgatt
cgcgtacccgcctcgctgtgcggggtgttcggcctgaagccgaccttcggccgcctgtcg
cggcacggcacccatccgttcgttgccagccttgaccatatcggcccgttcgcccgccgc
agcgaagacctggcatacgtttatgatgcgctgcagggacacgacgcgcaggatgccttt
caggcgaacgtggcggtgcagccggtgagcgggcagctgcatcgcggcatggaggggctg
cgctgcgcggtgctgggcggctttttccgccagtggagcgatgcggaggcgcagcaggcg
gtcgcgacagtggcgcgcgcgctggaagcgagcgaggagctgagcatagaagaggtggag
atcgcccgctcggcggcctttattattactgcttcggaagggggtaaccgctatctgcct
ttactgcgcagtcagcccgaacgttttgagccgctgtcgcgcgagcggttgctggcgggg
gcgatgctgcccgccgcctggtacgtgcaggcgcagcgttttcgtcgccattttcagcag
caggtgacggcgctgttcgctgatgttgatattctgattgcgcccgccacgccctgcagc
gccacgctgatgggccaggagagcatgacgattaacggccagacgctgccggtgcgcgcc
agcatggggatgctgacgcagcctatctcgtttctcggcctgccggtggtgaccgtgccg
ctgcaaaccgccagcggcctgccgatcggcgtgcagctgattgccgcgccgtttcaggag
gcgcgctgcctgcgtgccgcccgcgcgctggagcagatgggcattgcggcagcgccggtg
gcgaaagggagcatgtctgatgaattatga

DBGET integrated database retrieval system