KEGG   Mixta gaviniae: C2E15_14310Help
Entry
C2E15_14310       CDS       T05418                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pgz  Mixta gaviniae
Pathway
pgz00030  Pentose phosphate pathway
pgz01100  Metabolic pathways
pgz01110  Biosynthesis of secondary metabolites
pgz01120  Microbial metabolism in diverse environments
pgz01130  Biosynthesis of antibiotics
pgz01200  Carbon metabolism
pgz01230  Biosynthesis of amino acids
Module
pgz_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pgz_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pgz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C2E15_14310
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    C2E15_14310
Enzymes [BR:pgz01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     C2E15_14310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II YjeF_N DUF1241
Motif
Other DBs
NCBI-ProteinID: AUX94135
UniProt: A0A1X1DKX7
LinkDB All DBs
Position
3084925..3085923
Genome map
AA seq 332 aa AA seqDB search
MSQTQTQPRLTTSAMIASIAEEGQPTRAAPFGHALVELARQRQDIVGMTADLAKYTDLHI
FAQACPERFFQMGMAEQLLMGAAGGMAKEGFIPFVTTYAVFATRRAYDFIHQVIAEEQLN
VKIAAALPGLTTGYGPSHQATEDLAMMRGIPGMTIIDPCDALDIEQAVPAIAAHDGPVYM
RLLRGKVPAVLDEYDYRFEIGKARLLEEGRDVLLIASGIMTMRALAVARQLRQENISVAV
LHSPTIKPLDEETILAQAAKPGRLVITAENHTAPGGLSEAVAALLMRKGVHVDFDTITLP
DAFLDAGALPTLHDRYGISTAKMIAKIKARLG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaacgcaaacccaaccccgtttgaccacctcggcgatgatcgcctctattgcc
gaagagggccagccgacgcgcgctgcgccgttcggccatgcgctggtcgagctggcacgc
cagcggcaggatatcgtcggcatgaccgccgacctggcgaaatataccgatctgcacatt
ttcgcccaggcctgcccggaacgtttttttcagatgggcatggcggagcagctgctgatg
ggcgcggcgggcggcatggcgaaagagggctttattccctttgtcaccacctatgcggtg
ttcgccacgcgccgggcgtatgactttatccatcaggtgatcgccgaagagcagcttaac
gtaaagatcgccgccgccctgcccgggctgaccaccggctatggccccagccatcaggcg
acggaagatctggcgatgatgcgcggcattcccggcatgacgattatcgatccctgcgac
gcgctcgatatcgaacaggcggtgccggcgatagcggcgcacgacggcccggtttatatg
cgcctgctgcgtggcaaggtgccggcggtgctggatgagtatgattatcgctttgagatc
ggcaaagcgcggctgctggaagagggccgcgacgtgctgctgatcgcctccggcattatg
accatgcgcgcgctggcggtggcgcgccagctgcgccaggagaatatcagcgtcgcggtg
ctgcactcgccaaccatcaagccgctggacgaagagaccattctggcgcaggcggcgaag
ccgggacggctggtcatcaccgccgaaaaccataccgcgccgggcggcctgagcgaggcg
gtcgcggcgttgctgatgcgcaaaggcgtgcatgtcgattttgataccatcaccctgccc
gacgcgtttcttgatgccggcgcgctgccgacgctgcacgatcgttacggcatctctacg
gcgaaaatgatcgcgaagatcaaggcgcgactgggctga

DBGET integrated database retrieval system